DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynO and Atp5po

DIOPT Version :9

Sequence 1:NP_524358.2 Gene:ATPsynO / 41845 FlyBaseID:FBgn0016691 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_620238.1 Gene:Atp5po / 192241 RGDID:621379 Length:213 Species:Rattus norvegicus


Alignment Length:198 Identity:93/198 - (46%)
Similarity:131/198 - (66%) Gaps:7/198 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALLSRTLSSAAAQAT------VKPPVQVFGLEGRYATALYSAASKLSQLDQVEKDLTALQATIRS 66
            ::|||.:.|.:....      |:|||||:|:||||||||||||||..:||||||:|..:...:: 
  Rat     7 SVLSRQVRSFSTSVVRPFSKLVRPPVQVYGIEGRYATALYSAASKQKRLDQVEKELLRVGQLLK- 70

  Fly    67 DKKLREYVTSPIINKKVMATALKEASEKLRFAPATVNLLGLLADNGRLKKLDTVINAYKTIMAAH 131
            |.|:...|.:|.|.:.:...:||:.:.|.:|:|.|.||:.|||:||||.....||:|:.|||:.|
  Rat    71 DPKVSLAVLNPYIKRSIKVKSLKDITTKEKFSPLTANLMNLLAENGRLGNTQGVISAFSTIMSVH 135

  Fly   132 RGEVVCEVVTAKPLDASQSKQLEGALKSFLKGNESLKITSRVDPSIIGGLIVSIGDKYVDMSIAT 196
            ||||.|.|.||.|||.:...:|:..|.|||...:.|.:..:.||||:||:||.||:||||||..:
  Rat   136 RGEVPCTVTTAFPLDEAVLSELKTVLNSFLSKGQILNLEVKTDPSIMGGMIVRIGEKYVDMSAKS 200

  Fly   197 KVK 199
            |::
  Rat   201 KIQ 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynONP_524358.2 OSCP 32..199 CDD:278635 82/166 (49%)
Atp5poNP_620238.1 OSCP 37..209 CDD:395158 82/168 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354410
Domainoid 1 1.000 156 1.000 Domainoid score I4115
eggNOG 1 0.900 - - E1_COG0712
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1283
Inparanoid 1 1.050 173 1.000 Inparanoid score I3998
OMA 1 1.010 - - QHG57719
OrthoDB 1 1.010 - - D1178688at2759
OrthoFinder 1 1.000 - - FOG0004090
OrthoInspector 1 1.000 - - oto96098
orthoMCL 1 0.900 - - OOG6_101031
Panther 1 1.100 - - LDO PTHR11910
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3931
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.