DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and TSPYL5

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_277047.2 Gene:TSPYL5 / 85453 HGNCID:29367 Length:417 Species:Homo sapiens


Alignment Length:265 Identity:90/265 - (33%)
Similarity:144/265 - (54%) Gaps:45/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ADGNTSAAAGNNEEESE-----------ALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPC 68
            |..|||.:||..::|..           :::.::..|.:::.:|.:|....|::.:|:.:||...
Human   173 AGENTSVSAGEEKKEERDAGSGPPATEGSMDTLENVQLKLENMNAQADRAYLRLSRKFGQLRLQH 237

  Fly    69 YEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENP 133
            .|:|:.|::.||.||..:|.||||::..|:.:|:|.|..||.|||||....:.||:|.|:||.||
Human   238 LERRNHLIQNIPGFWGQAFQNHPQLASFLNSQEKEVLSYLNSLEVEELGLARLGYKIKFYFDRNP 302

  Fly   134 YFENKVLTKEFHLNSAAASENGDWPA----STSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYKT 194
            ||:||||.||:          |..|:    |.||||:|..|.:|..|....|..|        ::
Human   303 YFQNKVLIKEY----------GCGPSGQVVSRSTPIQWLPGHDLQSLSQGNPENN--------RS 349

  Fly   195 FFDWFSDNTDPVNDEIAELIKDDLWPNPLQYYLVPDIEVEPEDEEDNEDNDEEAFDDEDGEDGEG 259
            ||.|||:::...:|:|.|:|.::|||||||:||:            :|....|...:::|..|.|
Human   350 FFGWFSNHSSIESDKIVEIINEELWPNPLQFYLL------------SEGARVEKGKEKEGRQGPG 402

  Fly   260 EEEEE 264
            ::..|
Human   403 KQPME 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 75/210 (36%)
TSPYL5NP_277047.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..112
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..202 7/28 (25%)
NAP 205..382 CDD:415499 75/194 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 391..417 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152044
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.