DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and NAP1

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_012974.1 Gene:NAP1 / 853922 SGDID:S000001756 Length:417 Species:Saccharomyces cerevisiae


Alignment Length:399 Identity:89/399 - (22%)
Similarity:148/399 - (37%) Gaps:140/399 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRA-KLDGAPADGNTSAAA--------GN----------------NEEE--------------- 29
            ||.: ::|.||...||.|:.        ||                |||:               
Yeast     9 PKSSMQIDNAPTPHNTPASVLNPSYLKNGNPVRAQAQEQDDKIGTINEEDILANQPLLLQSIQDR 73

  Fly    30 -------------------SEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRS-- 73
                               .|.|..:...|:|:..:.::...|:.::|.|:.:..||.:|:||  
Yeast    74 LGSLVGQDSGYVGGLPKNVKEKLLSLKTLQSELFEVEKEFQVEMFELENKFLQKYKPIWEQRSRI 138

  Fly    74 -----------------------------------------ELVKRIPNFWVTSFINHPQVSGIL 97
                                                     |.||.||:||:|:..|.|.|...:
Yeast   139 ISGQEQPKPEQIAKGQEIVESLNETELLVDEEEKAQNDSEEEQVKGIPSFWLTALENLPIVCDTI 203

  Fly    98 DEEEEECLHALNKLEVEEFEDIKSGYRINFHFDE--NPYFENKVLTKE-FHLNSAAASENGDWPA 159
            .:.:.|.|..|..:.:|...|.:.|:::.|.||.  ||:|.|.:|.|. |:......|.:..:..
Yeast   204 TDRDAEVLEYLQDIGLEYLTDGRPGFKLLFRFDSSANPFFTNDILCKTYFYQKELGYSGDFIYDH 268

  Fly   160 STSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYK------------TFFDWF-------SDNTDP 205
            :....|.||:..:.:.:.|..    :|:||...|            :||::|       .|..:.
Yeast   269 AEGCEISWKDNAHNVTVDLEM----RKQRNKTTKQVRTIEKITPIESFFNFFDPPKIQNEDQDEE 329

  Fly   206 VNDE----------IAELIKDDLWPNPLQYY--LVPDIEVEPEDEEDNEDNDEEAFDDEDGEDGE 258
            :.::          |.|.:||.|.|..:.::  ...:.|.|.::||.:||.|||..||...||.:
Yeast   330 LEEDLEERLALDYSIGEQLKDKLIPRAVDWFTGAALEFEFEEDEEEADEDEDEEEDDDHGLEDDD 394

  Fly   259 GEEEEEDED 267
            ||..||.:|
Yeast   395 GESAEEQDD 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 58/272 (21%)
NAP1NP_012974.1 NAP 95..362 CDD:395763 57/270 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.