DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and NRP1

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001077822.1 Gene:NRP1 / 843797 AraportID:AT1G74560 Length:264 Species:Arabidopsis thaliana


Alignment Length:214 Identity:94/214 - (43%)
Similarity:135/214 - (63%) Gaps:36/214 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ESEALEQIDA-----------CQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNF 82
            |.|.||||||           .|::::.:|||||:|:|:||||||.:|||.|:||:|:::.||.|
plant    16 EEENLEQIDAELVLSIEKLQEIQDDLEKINEKASDEVLEVEQKYNVIRKPVYDKRNEVIQSIPGF 80

  Fly    83 WVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLN 147
            |:|:|::||.:..:|.||:::....||.||||:.:|:||||.|.|||..||:||:..|||.|...
plant    81 WMTAFLSHPALGDLLTEEDQKIFKYLNSLEVEDAKDVKSGYSITFHFTSNPFFEDAKLTKTFTFL 145

  Fly   148 SAAASENGDWPASTSTPIKWKEGKNLLKLLLTKPYG----NKK--KRNSEYKTFFDWFSDNT--- 203
            ....::      .|:|||||||||.|       |.|    :||  ||....::||.||:|..   
plant   146 EEGTTK------ITATPIKWKEGKGL-------PNGVNHDDKKGNKRALPEESFFTWFTDAQHKE 197

  Fly   204 ---DPVNDEIAELIKDDLW 219
               |.::||:|::||:|||
plant   198 DAGDEIHDEVADIIKEDLW 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 93/212 (44%)
NRP1NP_001077822.1 NAP 31..216 CDD:279323 84/197 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 133 1.000 Domainoid score I1644
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55707
Inparanoid 1 1.050 208 1.000 Inparanoid score I1266
OMA 1 1.010 - - QHG55441
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 1 1.000 - - otm3371
orthoMCL 1 0.900 - - OOG6_103113
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2181
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.