DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and NAP1;1

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_194341.1 Gene:NAP1;1 / 828717 AraportID:AT4G26110 Length:372 Species:Arabidopsis thaliana


Alignment Length:316 Identity:92/316 - (29%)
Similarity:148/316 - (46%) Gaps:79/316 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AGNNEEESEAL-----EQIDA---CQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELV--- 76
            ||...:..|.|     :::||   .|::.|.|..|..||...:|.||..|.:|.|.||.|:|   
plant    37 AGQRSDVLENLTPNVRKRVDALRDIQSQHDELEAKFREERAILEAKYQTLYQPLYVKRYEIVNGT 101

  Fly    77 -----------------------KRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFED 118
                                   |.:|:||:|:..|:..:|..:.|.:|..|..|..::..:.|:
plant   102 TEVELAPEDDTKVDQGEEKTAEEKGVPSFWLTALKNNDVISEEVTERDEGALKYLKDIKWCKIEE 166

  Fly   119 IKSGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWP---ASTSTPIKWKEGKNLL-KLLLT 179
            .| |:::.|.||.||||:|.||||.:|:      .:.|.|   .:..|.|.|..||.|. |:|..
plant   167 PK-GFKLEFFFDTNPYFKNTVLTKSYHM------IDEDEPLLEKAMGTEIDWYPGKCLTQKILKK 224

  Fly   180 KPYGNKKKRNS-------EYKTFFDWFS-----DNTDPVNDEIAE--------------LIKDDL 218
            ||  .|..:|:       :.::||::||     |..:.:::|.||              .|::.:
plant   225 KP--KKGSKNTKPITKLEDCESFFNFFSPPEVPDEDEDIDEERAEDLQNLMEQDYDIGSTIREKI 287

  Fly   219 WPNPLQYYL-----VPDIEVEPEDEEDNEDNDEEAFDDEDGEDGEGEEEEEDEDDK 269
            .|..:.::.     ..|.|:: :||||:.|.||:..|:||.||.:.|:|||.:..|
plant   288 IPRAVSWFTGEAMEAEDFEID-DDEEDDIDEDEDEEDEEDEEDDDDEDEEESKTKK 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 71/259 (27%)
NAP1;1NP_194341.1 NAP 53..297 CDD:279323 69/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.