DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and NAP1;4

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001319544.1 Gene:NAP1;4 / 820589 AraportID:AT3G13782 Length:317 Species:Arabidopsis thaliana


Alignment Length:260 Identity:72/260 - (27%)
Similarity:112/260 - (43%) Gaps:67/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DALNEKASEEILKVEQKYNKLRKPCYEKRSELV----------KRIPNFWVTSFINHPQVSGILD 98
            |.|.||...|...:|..|:.|.||.:.||.|:|          :.:||||:.:...:..::..:.
plant    71 DELEEKFLAEKSALEATYDNLYKPLFAKRYEIVNGVVEAEAEKEGVPNFWLIAMKTNEMLANEIT 135

  Fly    99 EEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPA---S 160
            |.:|..|..|..:.....||....:::.|.||.|.||:|.||:|.:|:|      :.|.|.   .
plant   136 ERDEAALKYLKDIRSCRVEDTSRNFKLEFLFDSNLYFKNSVLSKTYHVN------DEDGPVLEKV 194

  Fly   161 TSTPIKWKEGKNLLKLLLTK---PYGNKKKRN------SEYKTFFDWFS-------DNTDPVND- 208
            ..|.|:|..||.|...::.|   ..|.||..|      ...::||::|.       |..|..:| 
plant   195 IGTDIEWFPGKCLTHKVVVKKKTKKGPKKVNNIPMTKTENCESFFNFFKPPEIPEIDEVDDYDDF 259

  Fly   209 ----------------EIAELIKDDLWPNPLQYY----LVPDIEVEPEDEEDNEDNDEEAFDDED 253
                            :||..|:|.|.|:.:.::    ||        ||:|::|||:   ||.|
plant   260 DTIMTEELQNLMDQDYDIAVTIRDKLIPHAVSWFTGEALV--------DEDDSDDNDD---DDND 313

  Fly   254  253
            plant   314  313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 61/232 (26%)
NAP1;4NP_001319544.1 NAP 58..296 CDD:395763 61/230 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.