DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and TSPY4

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001157943.1 Gene:TSPY4 / 728395 HGNCID:37287 Length:314 Species:Homo sapiens


Alignment Length:216 Identity:71/216 - (32%)
Similarity:121/216 - (56%) Gaps:18/216 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHPQVSGI 96
            |||::.|.|.|::.:|.:|.:...:..:|..:.|||..::|..:::.:|.||.....||||:|.:
Human   114 ALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSAL 178

  Fly    97 LDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPAST 161
            :.:|:|:.|..:..|||||.:......:|...|..||||:|||:|||:.:|..      ::.||.
Human   179 ITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNIT------EYRASH 237

  Fly   162 STPIKWKEGKNLLKLLLTKPYGNKKKRNSEYKTFFDWFSDNTDPVNDEIAELIKDDLWPNPLQYY 226
            ||||:|.....:      :.|  :::.::....||:||||:....:::|||::..|||.||||||
Human   238 STPIEWYPDYEV------EAY--RRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYY 294

  Fly   227 LVPDIEVEPEDEEDNEDNDEE 247
            .    .::|.:|......|.:
Human   295 K----RMKPPEEGTETSGDSQ 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 67/194 (35%)
TSPY4NP_001157943.1 NAP 132..294 CDD:298680 59/175 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55441
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.