DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and TSPYL1

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_003300.1 Gene:TSPYL1 / 7259 HGNCID:12382 Length:437 Species:Homo sapiens


Alignment Length:237 Identity:79/237 - (33%)
Similarity:132/237 - (55%) Gaps:28/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KRAKLDGAPADGNTSAAAGNNEEESEALEQ--------------IDACQNEIDALNEKASEEILK 56
            ::.:::..|.:|.....|..:..|.||.|:              ::|.|.|:|.:|.:|.....:
Human   188 EQMEVEEQPPEGEEIEVAEEDRLEEEAREEEGPWPLHEALRMDPLEAIQLELDTVNAQADRAFQQ 252

  Fly    57 VEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKS 121
            :|.|:.::|:...|:|:.:::.||.||:|:|.||||:|.::..::.|.|..:..|||:|....::
Human   253 LEHKFGRMRRHYLERRNYIIQNIPGFWMTAFRNHPQLSAMIRGQDAEMLRYITNLEVKELRHPRT 317

  Fly   122 GYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKK 186
            |.:..|.|..||||.||::.||:.:.|:..      ..|.||||.|:.|.        :|....:
Human   318 GCKFKFFFRRNPYFRNKLIVKEYEVRSSGR------VVSLSTPIIWRRGH--------EPQSFIR 368

  Fly   187 KRNSEYKTFFDWFSDNTDPVNDEIAELIKDDLWPNPLQYYLV 228
            :......:||.||||::.|.:|:|||:||:|||||||||||:
Human   369 RNQDLICSFFTWFSDHSLPESDKIAEIIKEDLWPNPLQYYLL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 73/209 (35%)
TSPYL1NP_003300.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81
NAP 228..409 CDD:279323 70/194 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152057
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.