DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and Tspyl4

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_084479.1 Gene:Tspyl4 / 72480 MGIID:106393 Length:406 Species:Mus musculus


Alignment Length:225 Identity:75/225 - (33%)
Similarity:127/225 - (56%) Gaps:24/225 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AGNNEEES-------EALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIP 80
            ||..:||:       ..::.::|...|:..:|.:|....|::|:|:.::|:...::||.:::.||
Mouse   179 AGGGKEETRPRAPKINCMDSLEAIDQELSNVNAQADRAFLQLERKFGRMRRLHMQRRSFIIQNIP 243

  Fly    81 NFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFH 145
            .||||:|.||||:|.::..::|:.:..:..|||||.:..:.|.:..|.|..||||.|:.|.||:.
Mouse   244 GFWVTAFRNHPQLSPMISGQDEDMMRYMINLEVEELKQPRVGCKFKFIFQSNPYFRNEGLVKEYE 308

  Fly   146 LNSAAASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYKTFFDWFSDNTDPVNDEI 210
            ..|:..      ..|.||||:|..|:.      .:.:.::.:..:...:||:||||::....|.|
Mouse   309 RRSSGR------VVSLSTPIRWHRGQE------PQAHIHRNREGNTIPSFFNWFSDHSLLEFDRI 361

  Fly   211 AELIKDDLWPNPLQYYLVPD-----IEVEP 235
            ||:||.:||.|||||||:.|     :.|.|
Mouse   362 AEIIKGELWSNPLQYYLMGDGPRRGVRVPP 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 66/195 (34%)
Tspyl4NP_084479.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..121
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..189 4/9 (44%)
NAP 218..378 CDD:415499 62/171 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..406 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842142
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.