DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and Nap1l5

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001037758.1 Gene:Nap1l5 / 688843 RGDID:1584123 Length:155 Species:Rattus norvegicus


Alignment Length:135 Identity:33/135 - (24%)
Similarity:51/135 - (37%) Gaps:39/135 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DGAPADGNTSAAAGNNEEESE----------------------ALEQIDACQNEIDALNEKASEE 53
            |.|..|..|:.||...:..:|                      ||:::   |...|.:..|..:|
  Rat    27 DAATGDSATAPAAEEPQAPAENAPKPKNDFIESLPNPVKCRVLALKKL---QKRCDKIEAKFDKE 88

  Fly    54 ILKVEQKYNKLRKPCYEKRSELVKRIPN-FWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFE 117
            ...:|:|||.:.||...|..||...:.. .|.        :.|..||::||     .:.|.||.|
  Rat    89 FQALEKKYNDIYKPLLAKIQELTGEMEGCAWT--------LEGEDDEDDEE-----EEDEEEEEE 140

  Fly   118 DIKSG 122
            :..:|
  Rat   141 EAAAG 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 27/115 (23%)
Nap1l5NP_001037758.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..60 7/32 (22%)
NAP 67..>106 CDD:298680 12/41 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..155 11/40 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345561
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.