DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and SETSIP

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001274666.1 Gene:SETSIP / 646817 HGNCID:42937 Length:302 Species:Homo sapiens


Alignment Length:292 Identity:163/292 - (55%)
Similarity:206/292 - (70%) Gaps:38/292 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSVPKR--------AKLDGAPADG--NTSAAAG----NNEEESEALEQIDACQNEIDALNEKASE 52
            |..|||        .|....||.|  .|||:||    ..:|:.||:|.||..|||||.|||:.||
Human    10 SMAPKRQSPLPLQKKKPRPPPALGLEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQDSE 74

  Fly    53 EILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFE 117
            |||||||||||||:|.::|||||:.:||||.||:|:||||||.:|.||:||.||.|.|:||.|||
Human    75 EILKVEQKYNKLRQPFFQKRSELIAKIPNFGVTTFVNHPQVSSLLGEEDEEALHYLTKVEVTEFE 139

  Fly   118 DIKSGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPASTSTPIKWKEGKNLLK-LLLTKP 181
            ||||||||:|:|||||||||||.:||||||     |:|| |:|.||.||||.||::.| ...|:.
Human   140 DIKSGYRIDFYFDENPYFENKVFSKEFHLN-----ESGD-PSSKSTKIKWKSGKDVTKRSSQTQN 198

  Fly   182 YGNKKKRNSEYKTFFDWFSDNTDPVNDEIAELIKDDLWPNPLQYYLVPDIEVEPEDEEDNEDNDE 246
            ..::|:::.|.::||.||:|::|...||:.|:||||:||||||||||||:    :|||..||:|:
Human   199 KASRKRQHEEPESFFTWFTDHSDAGADELEEVIKDDIWPNPLQYYLVPDM----DDEEGGEDDDD 259

  Fly   247 EAFDDEDGEDGEGE----------EEEEDEDD 268
               ||:||::||.|          |.||||||
Human   260 ---DDDDGDEGEEELEDIDEGDEDEGEEDEDD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 124/196 (63%)
SETSIPNP_001274666.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 14/42 (33%)
NAP 60..244 CDD:279323 119/189 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..302 64/134 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151998
Domainoid 1 1.000 197 1.000 Domainoid score I3099
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 311 1.000 Inparanoid score I2596
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55441
OrthoDB 1 1.010 - - D518537at33208
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 1 1.000 - - otm42145
orthoMCL 1 0.900 - - OOG6_103113
Panther 1 1.100 - - LDO PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2181
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.