DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and SET

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_016870502.1 Gene:SET / 6418 HGNCID:10760 Length:309 Species:Homo sapiens


Alignment Length:274 Identity:158/274 - (57%)
Similarity:211/274 - (77%) Gaps:17/274 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRAKLDGAPADG--NTSAAAG----NNEEESEALEQIDACQNEIDALNEKASEEILKVEQKYNK 63
            |::.|....||.|  .|||:||    ..:|:.||:|.||..|||||.|||:||||||||||||||
Human    11 PQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNK 75

  Fly    64 LRKPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFH 128
            ||:|.::|||||:.:|||||||:|:||||||.:|.||:||.||.|.::||.|||||||||||:|:
Human    76 LRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFY 140

  Fly   129 FDENPYFENKVLTKEFHLNSAAASENGDWPASTSTPIKWKEGKNLLK-LLLTKPYGNKKKRNSEY 192
            ||||||||||||:||||||     |:|| |:|.||.||||.||:|.| ...|:...::|:::.|.
Human   141 FDENPYFENKVLSKEFHLN-----ESGD-PSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEP 199

  Fly   193 KTFFDWFSDNTDPVNDEIAELIKDDLWPNPLQYYLVPDIEVE--PEDEEDNEDNDEEAFD--DED 253
            ::||.||:|::|...||:.|:||||:||||||||||||::.|  ..:|:|::|.:||..:  ||:
Human   200 ESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEE 264

  Fly   254 GEDGEGEEEEEDED 267
            |::.||||:|:|::
Human   265 GDEDEGEEDEDDDE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 127/196 (65%)
SETXP_016870502.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 197 1.000 Domainoid score I3099
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55707
Inparanoid 1 1.050 311 1.000 Inparanoid score I2596
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55441
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 1 1.000 - - otm42145
orthoMCL 1 0.900 - - OOG6_103113
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R11118
SonicParanoid 1 1.000 - - X2181
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.