DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and TSPYL2

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_016885215.1 Gene:TSPYL2 / 64061 HGNCID:24358 Length:738 Species:Homo sapiens


Alignment Length:438 Identity:93/438 - (21%)
Similarity:150/438 - (34%) Gaps:209/438 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NNEEESEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFIN 89
            |.|.....|:.::..|.:::|:|.||.:..|::::|:.::|:|..|:|..:::.||.|||.:|:|
Human   208 NAERMESILQALEDIQLDLEAVNIKAGKAFLRLKRKFIQMRRPFLERRDLIIQHIPGFWVKAFLN 272

  Fly    90 HPQVSGILDEEEEECLHALNKLEV----------------------------------------- 113
            ||::|.:::..:|:....|..|:|                                         
Human   273 HPRISILINRRDEDIFRYLTNLQVRPERHFLVGSGTNLVLGGDGRWVGRAVVCWGGDRFHHHPHL 337

  Fly   114 EEFED---IKSGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPASTSTPIKWKEGKNLLK 175
            |:.:|   |..||::..:|..||||.|.|:.|||..|.:...      .|.||||:|..|:    
Human   338 EQVQDLRHISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRL------VSHSTPIRWHRGQ---- 392

  Fly   176 LLLTKPYGNKKKRNSEYKTFFDWFSDNTDPVNDEIAELIKDDLWPNPLQYYL------------- 227
                :|...:........:||.|||:::.|..|.|||:||:|||.|||:|||             
Human   393 ----EPQARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQE 453

  Fly   228 -------------------------------------VPDIEV---------------------- 233
                                                 :.||::                      
Human   454 MKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINE 518

  Fly   234 ------------------------------------------EPEDE----EDNEDND------- 245
                                                      .|||.    :|||:|.       
Human   519 NICDSENPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNTDDNEENPNNNENTY 583

  Fly   246 --------------------------EEAFDDEDGEDGEGEEEEEDED 267
                                      :||.||||.:..||:.|..|:|
Human   584 GNNFFKGGFWGSHGNNQDSSDSDNEADEASDDEDNDGNEGDNEGSDDD 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 69/239 (29%)
TSPYL2XP_016885215.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152045
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.