DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Set and Nap1l5

DIOPT Version :9

Sequence 1:	NP_650438.2	Gene:	Set / 41844	FlyBaseID:	FBgn0014879	Length:	269	Species:	Drosophila melanogaster
Sequence 2:	NP_067407.1	Gene:	Nap1l5 / 58243	MGIID:	1923555	Length:	156	Species:	Mus musculus

Alignment Length:	140	Identity:	34/140 - (24%)
Similarity:	54/140 - (38%)	Gaps:	39/140 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly    10 LDGA-----PADGNTSAAAGNNEEES-------------EALEQIDAC--------QNEIDALNE 48
            ::||     .|.|:::||....|.::             |:|.....|        |...|.:..
Mouse    19 MEGAQGGEDAATGDSAAAPAAEEPQAPAENAPKPKKDFMESLPNSVKCRVLALKKLQKRCDKIEA 83

  Fly    49 KASEEILKVEQKYNKLRKPCYEKRSELVKRIPN-FWVTSFINHPQVSGILDEEEEECLHALNKLE 112
            |..:|...:|:|||.:.||...|..||...:.. .|.        :.|..||::||    .:..|
Mouse    84 KFDKEFQALEKKYNDIYKPLLAKIQELTGEMEGCAWT--------LEGEDDEDDEE----EDDEE 136

  Fly   113 VEEFEDIKSG 122
            .||.|:..:|
Mouse   137 EEEEEEAAAG 146

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Set	NP_650438.2	NAP	31..227	CDD:279323	27/101 (27%)
Nap1l5	NP_067407.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..58		7/38 (18%)
		NAP	67..>115	CDD:415499	13/47 (28%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	120..156		10/39 (26%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167842140
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930