DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and tspyl2

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001016811.1 Gene:tspyl2 / 549565 XenbaseID:XB-GENE-1016996 Length:495 Species:Xenopus tropicalis


Alignment Length:280 Identity:103/280 - (36%)
Similarity:166/280 - (59%) Gaps:51/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NTSAAAGNNEEESEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNF 82
            :||.|:        :|:.:::.|.|:.|:||:|....|:::::|..||:|..:||::::::||.|
 Frog   186 HTSTAS--------SLQALESIQKELRAVNERADRAFLQLKRRYGHLRRPHIQKRNDIIRKIPGF 242

  Fly    83 WVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLN 147
            |||:|:||||:|.::|:.:|:.|..:|.|:||:|...|:..:|.|:|:.||||:|:|:.|||...
 Frog   243 WVTAFLNHPQLSAMIDDRDEDTLSYMNNLQVEDFTHTKASCKIKFYFNPNPYFKNEVIIKEFQYG 307

  Fly   148 SAAASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYKTFFDWFSDNTDPVNDEIAE 212
            |:...      .|.||||:|..|:|        | ..:.|.:....:||.||||::.|..|.||.
 Frog   308 SSGRL------VSRSTPIRWWRGQN--------P-AYRGKSSGSAPSFFSWFSDHSFPAADRIAA 357

  Fly   213 LIKDDLWPNPLQYYLVPDIEVEPEDEEDN-EDNDEEAF----DDEDGEDGE-------------- 258
            :||:|||||||:|||:.:.|.:....||: .||.::..    ||::|||||              
 Frog   358 IIKEDLWPNPLEYYLIGEGESDDNGVEDSGSDNADDCVVIVDDDDEGEDGEDEYEENDVHEISDN 422

  Fly   259 ---------GEEEEEDEDDK 269
                     ||||||:||::
 Frog   423 TEKQTEGTDGEEEEEEEDEE 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 78/195 (40%)
tspyl2NP_001016811.1 NAP 215..380 CDD:385322 74/179 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.