DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and Nap1l3

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_620081.1 Gene:Nap1l3 / 54561 MGIID:1859565 Length:544 Species:Mus musculus


Alignment Length:254 Identity:53/254 - (20%)
Similarity:101/254 - (39%) Gaps:57/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EEESEALEQIDACQNEIDALNE----------KASEEI---------------LKVEQKYNKLRK 66
            ||::::.:.||....|.:.:.|          :.:||.               .:.|:..|..|.
Mouse   272 EEKADSTDCIDIAPEEKEDVKEVTQANTENKDQPTEEFTPRAPAREAQKRVPETRPEEGVNIKRA 336

  Fly    67 PCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKS--GYRINFHF 129
            ...:.:.|..|.||::|:|...|..::..::.:.:|..|..|:.:.: :|.:...  ||...|||
Mouse   337 RKGKPKKEDPKGIPDYWLTVLKNVDKLGPMIQKCDEPILKFLSDVSL-KFSNPGQPIGYTFEFHF 400

  Fly   130 DENPYFENKVLTKEFHLNSAAASENGD------WPAS--TSTPIKWKEGKNLLKLLLTKPYG--- 183
            ..||||.|::|.|.:.:.|  ..::.|      |...  ....|.|:.||::.........|   
Mouse   401 LPNPYFRNELLMKTYIIRS--KPDHYDPFFAWGWEIEECKGCKIDWRRGKDVTVTTTRSRPGITG 463

  Fly   184 --NKKKRNSEYKTFFDWFS-------DNTDPVND-------EIAELIKDDLWPNPLQYY 226
              ..:.|.....:||::||       ...:|..|       ||.:::.|::....:.|:
Mouse   464 EIEVQPRVVPNASFFNFFSPPEIPLIGKLEPREDAILDEDFEIGQILHDNVILKSIYYF 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 51/250 (20%)
Nap1l3NP_620081.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..109
NAP 117..>157 CDD:298680
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..345 11/72 (15%)
NAP 352..524 CDD:279323 38/174 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842143
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.