Sequence 1: | NP_650438.2 | Gene: | Set / 41844 | FlyBaseID: | FBgn0014879 | Length: | 269 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001345298.1 | Gene: | Tspyl2 / 52808 | MGIID: | 106244 | Length: | 678 | Species: | Mus musculus |
Alignment Length: | 393 | Identity: | 89/393 - (22%) |
---|---|---|---|
Similarity: | 156/393 - (39%) | Gaps: | 160/393 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 AAGNNEEESEALEQI----DACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNF 82
Fly 83 WVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLN 147
Fly 148 SAAASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYKTFFDWFSDNTDPVNDEIAE 212
Fly 213 LIKDDLWPNPLQYYL-------------------------------------------------- 227
Fly 228 -----VPDIEV------------------------------------------------------ 233
Fly 234 --EPE-----DEED--------------------------NEDNDEEAFDDEDGEDGEGEEEEED 265
Fly 266 EDD 268 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Set | NP_650438.2 | NAP | 31..227 | CDD:279323 | 66/199 (33%) |
Tspyl2 | NP_001345298.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..54 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 175..202 | 2/7 (29%) | |||
NAP | 209..388 | CDD:307208 | 63/192 (33%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 470..659 | 18/103 (17%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167842139 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1508 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1191764at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11875 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
6 | 5.810 |