DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and Tspyl2

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001345298.1 Gene:Tspyl2 / 52808 MGIID:106244 Length:678 Species:Mus musculus


Alignment Length:393 Identity:89/393 - (22%)
Similarity:156/393 - (39%) Gaps:160/393 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AAGNNEEESEALEQI----DACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNF 82
            |..:.|..::.:|.|    ::.|.:::|:|.||.:..|::::|:.::|:|..|:|..:::.||.|
Mouse   194 AKESRERSAQRMESILQALESIQMDLEAVNIKAGKAFLRLKRKFIQMRRPFLERRDLIIQHIPGF 258

  Fly    83 WVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLN 147
            ||.:|:|||::|.::::.:.:....|..|:|::...|..||::..:|..||||.|.|:.|||..|
Mouse   259 WVKAFLNHPRISILINQRDRDIFRYLTNLQVQDLRHISMGYKMKLYFQTNPYFTNMVIVKEFQRN 323

  Fly   148 SAAASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYKTFFDWFSDNTDPVNDEIAE 212
            .:...      .|.||||:|..|:        :|....::.:...::||:|||:::.|..|.|||
Mouse   324 RSGRL------VSHSTPIRWHRGQ--------EPQAYNRRSHDTRESFFNWFSNHSLPEADRIAE 374

  Fly   213 LIKDDLWPNPLQYYL-------------------------------------------------- 227
            :||:|||.||::||:                                                  
Mouse   375 IIKNDLWVNPVRYYMRRGGYRSSRKKQHGKESRAKNQYEMVIMEDAHDHYAIEDILSDISEIDEI 439

  Fly   228 -----VPDIEV------------------------------------------------------ 233
                 :.||::                                                      
Mouse   440 TDNETIHDIKISDFMETTDYFETTDNEVTDANENLCDSENPDHSEGYNTKITDNKGSVAANPDDN 504

  Fly   234 --EPE-----DEED--------------------------NEDNDEEAFDDEDGEDGEGEEEEED 265
              :||     |.||                          :.||.:|..||||.:..||:.|..|
Mouse   505 SDDPEEKNTYDSEDSNSEKADGDNTTLRDNQQVTNIQDSSDSDNGDEGSDDEDDDGNEGDNEGSD 569

  Fly   266 EDD 268
            :||
Mouse   570 DDD 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 66/199 (33%)
Tspyl2NP_001345298.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..202 2/7 (29%)
NAP 209..388 CDD:307208 63/192 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 470..659 18/103 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842139
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.