powered by:
Protein Alignment Set and LOC499544
DIOPT Version :9
Sequence 1: | NP_650438.2 |
Gene: | Set / 41844 |
FlyBaseID: | FBgn0014879 |
Length: | 269 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001041409.1 |
Gene: | LOC499544 / 499544 |
RGDID: | 1560001 |
Length: | 201 |
Species: | Rattus norvegicus |
Alignment Length: | 45 |
Identity: | 12/45 - (26%) |
Similarity: | 24/45 - (53%) |
Gaps: | 5/45 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 151 ASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYKTF 195
|::..|..::...|:..:|..|.||.:. ||.:| :|::.|:
Rat 9 ATKPEDLSSNPRPPLGRRECLNPLKAMT----GNLQK-DSQWSTY 48
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Set | NP_650438.2 |
NAP |
31..227 |
CDD:279323 |
12/45 (27%) |
LOC499544 | NP_001041409.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166345562 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000644 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.930 |
|
Return to query results.
Submit another query.