DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and LOC499544

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001041409.1 Gene:LOC499544 / 499544 RGDID:1560001 Length:201 Species:Rattus norvegicus


Alignment Length:45 Identity:12/45 - (26%)
Similarity:24/45 - (53%) Gaps:5/45 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 ASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYKTF 195
            |::..|..::...|:..:|..|.||.:.    ||.:| :|::.|:
  Rat     9 ATKPEDLSSNPRPPLGRRECLNPLKAMT----GNLQK-DSQWSTY 48

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 12/45 (27%)
LOC499544NP_001041409.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345562
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.