DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and NAP1L4

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001356309.1 Gene:NAP1L4 / 4676 HGNCID:7640 Length:386 Species:Homo sapiens


Alignment Length:377 Identity:92/377 - (24%)
Similarity:142/377 - (37%) Gaps:135/377 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DGAPADGNTSAAAGNNEEESEAL---------------EQID---------------ACQNEIDA 45
            ||.|:|   |..|..|...:|.|               |::|               |.:..|:|
Human     8 DGVPSD---SVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINA 69

  Fly    46 LNE----------KASEEILKVEQKYNKLRKPCYEKRSELV------------------------ 76
            |.:          |..||:..:|:||..|.:|.::||.|.:                        
Human    70 LKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSENEEEEKLA 134

  Fly    77 ----------------------KRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFED- 118
                                  |.||.||.|.|.|...:|.::.|.:|..|..|..::| :|.| 
Human   135 GDMKSKVVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKV-KFSDP 198

  Fly   119 -IKSGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPASTSTP---------IKWKEGKNL 173
             ....:.:.|||:.|.||.|.||||.:.:.|  ..:..| |.|...|         |.||:|||:
Human   199 GQPMSFVLEFHFEPNDYFTNSVLTKTYKMKS--EPDKAD-PFSFEGPEIVDCDGCTIDWKKGKNV 260

  Fly   174 LKLLLTKPYGNKKK-------RNSEYKTFFDWF---------------SDNTDPVNDEIAELIKD 216
            ....:.|...:|.:       :....::||::|               |:.|...:.||....::
Human   261 TVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRE 325

  Fly   217 DLWPNPLQYYLVPDIEVEPEDEEDNEDNDEEAFDDEDGEDGEGEEEEEDEDD 268
            .:.|..:.|:....||        ::||.||..:.|: |:.||:||.|||||
Human   326 RIVPRAVLYFTGEAIE--------DDDNFEEGEEGEE-EELEGDEEGEDEDD 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 68/314 (22%)
NAP1L4NP_001356309.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 9/25 (36%)
NAP 67..337 CDD:334326 63/273 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..137 0/20 (0%)
Nuclear localization signal. /evidence=ECO:0000255 265..271 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.