DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and NAP1L3

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_004529.2 Gene:NAP1L3 / 4675 HGNCID:7639 Length:506 Species:Homo sapiens


Alignment Length:249 Identity:56/249 - (22%)
Similarity:105/249 - (42%) Gaps:62/249 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EEESEALEQIDACQNE------------IDALNEKASEEILK--VEQKYNKLRKPCYEKRSELVK 77
            :|:.:.:.|:.|...|            :...:::..||.|:  |:.|..:..||   ||.: .|
Human   249 KEDPKEVPQVKADDKEQPKATEAKARAAVRETHKRVPEERLQDSVDLKRARKGKP---KRED-PK 309

  Fly    78 RIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSG----YRINFHFDENPYFENK 138
            .||::|:....|..::..::.:.:|..|..|:.:.: :|.  |.|    |...|||..||||.|:
Human   310 GIPDYWLIVLKNVDKLGPMIQKYDEPILKFLSDVSL-KFS--KPGQPVSYTFEFHFLPNPYFRNE 371

  Fly   139 VLTKEFHLNSAAASENGD------WPAS--TSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYK-- 193
            ||.|.:.:.  |..::.|      |...  ....|.|:.||: :.:..|:   ::.....|.:  
Human   372 VLVKTYIIK--AKPDHNDPFFSWGWEIEDCKGCKIDWRRGKD-VTVTTTQ---SRTTATGEIEIQ 430

  Fly   194 -------TFFDWFS-------DNTDPVND-------EIAELIKDDLWPNPLQYY 226
                   :||::||       ...:|..|       ||.:::.|::....:.||
Human   431 PRVVPNASFFNFFSPPEIPMIGKLEPREDAILDEDFEIGQILHDNVILKSIYYY 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 55/245 (22%)
NAP1L3NP_004529.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..95
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..307 13/60 (22%)
NAP 314..486 CDD:279323 40/180 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152049
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.