DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and NAP1L2

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_068798.1 Gene:NAP1L2 / 4674 HGNCID:7638 Length:460 Species:Homo sapiens


Alignment Length:225 Identity:60/225 - (26%)
Similarity:98/225 - (43%) Gaps:57/225 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EEESEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHP 91
            |||.|..|     :::|:|..|:..||                    |..|.||:||:|...|..
Human   213 EEEEEEEE-----EDDIEATGEENKEE--------------------EDPKGIPDFWLTVLKNVD 252

  Fly    92 QVSGILDEEEEECLHALNKLEVEEFEDIKS-GYRINFHFDENPYFENKVLTKEFHLNSAAASENG 155
            .::.::.:.:|..|..|..::|:..:..:. .:.:.|||..|.||:|::|||.:.|.|..|..: 
Human   253 TLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNELLTKTYVLKSKLAYYD- 316

  Fly   156 DWP---------ASTSTPIKWKEGKNL-LKLLLTKP----YGNKKKRNSEY--KTFFDWFS---- 200
              |         .||...|.|.||||: ||.:..|.    :|..:....::  .:||::||    
Human   317 --PHPYRGTAIEYSTGCEIDWNEGKNVTLKTIKKKQKHRIWGTIRTVTEDFPKDSFFNFFSPHGI 379

  Fly   201 -DNTDPVNDEIAELIKDDLWPNPLQYYLVP 229
             .|....||       |.|..:.|:.|::|
Human   380 TSNGRDGND-------DFLLGHNLRTYIIP 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 55/217 (25%)
NAP1L2NP_068798.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88
NAP 111..410 CDD:279323 60/225 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..238 10/48 (21%)
Nuclear localization signal. /evidence=ECO:0000255 346..352 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152047
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.