DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and NAP1L1

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001317160.1 Gene:NAP1L1 / 4673 HGNCID:7637 Length:391 Species:Homo sapiens


Alignment Length:336 Identity:86/336 - (25%)
Similarity:142/336 - (42%) Gaps:94/336 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DGNTSAAAGNNEEESEALE-QIDACQN------EIDALNEKASEEILKVEQKYNKLRKPCYEKRS 73
            ||......|..|.....:: :::|.:|      :|:|   |..||:..:|:||..|.:|.::||.
Human    57 DGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEA---KFYEEVHDLERKYAVLYQPLFDKRF 118

  Fly    74 ELV-------------------------------------------KRIPNFWVTSFINHPQVSG 95
            |::                                           |.||.||:|.|.|...:|.
Human   119 EIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSD 183

  Fly    96 ILDEEEEECLHALNKLEVEEFEDI--KSGYRINFHFDENPYFENKVLTKEFHLNSAAASENG--- 155
            ::.|.:|..|..|..::| :|.|.  ...:.:.|||:.|.||.|:||||.:.:.|.....:.   
Human   184 MVQEHDEPILKHLKDIKV-KFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSF 247

  Fly   156 DWP---ASTSTPIKWKEGKNL-LKLLLTKPYGNKKKRNSEYKT---------FFDWFS------- 200
            |.|   ..|...|.||:|||: ||.:..|   .|.|.....:|         ||::|:       
Human   248 DGPEIMGCTGCQIDWKKGKNVTLKTIKKK---QKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPES 309

  Fly   201 ----DNTDPV---NDEIAELIKDDLWPNPLQYYLVPDIEVEPEDEEDNEDNDEEAFDDEDGEDGE 258
                |:.:.:   :.||...:::.:.|..:.|:....||   :|::|.::..|||  ||:||:..
Human   310 GDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIE---DDDDDYDEEGEEA--DEEGEEEG 369

  Fly   259 GEEEEEDEDDK 269
            .||.:.|.|.|
Human   370 DEENDPDYDPK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 66/277 (24%)
NAP1L1NP_001317160.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
NAP 76..343 CDD:307208 66/273 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..163 0/30 (0%)
Nuclear localization signal. /evidence=ECO:0000255 273..279 1/8 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 346..391 16/40 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.