DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and gmip

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_031753686.1 Gene:gmip / 448355 XenbaseID:XB-GENE-977540 Length:950 Species:Xenopus tropicalis


Alignment Length:199 Identity:40/199 - (20%)
Similarity:71/199 - (35%) Gaps:61/199 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KRAKLDGAP------ADGNTSAAAGNNEEESEALEQIDACQNEIDALNEKASEEILKVEQKYNKL 64
            ::|||..|.      |.|:|.:|....|:..::.|:..:...|.:|......:|.....|:..|:
 Frog   297 EKAKLLSAKIEEEQIASGHTGSANKLVEKRRKSREEAQSKAIEAEASYRSCVQEANARSQQQEKV 361

  Fly    65 RKPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHF 129
            |:.                :.|.|....:.|  |:..:|....|.:::..:||.|..||      
 Frog   362 RER----------------IVSHIRKLIIQG--DQVLKEVTMNLLRMKQSQFEAIPCGY------ 402

  Fly   130 DENPYFENKVLTKEFHLNSAAASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYKT 194
                                     ||. .:|..|  ::.|...|:.:||.|   :|..:.|..|
 Frog   403 -------------------------GDL-LTTCDP--YESGTRYLQFILTLP---RKHTDPEKFT 436

  Fly   195 FFDW 198
            |.::
 Frog   437 FEEY 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 31/168 (18%)
gmipXP_031753686.1 BAR 156..380 CDD:416402 20/100 (20%)
C1_GMIP-like 575..624 CDD:410366
RhoGAP_GMIP 632..827 CDD:239873
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.