DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and mil

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_651592.2 Gene:mil / 43343 FlyBaseID:FBgn0267366 Length:283 Species:Drosophila melanogaster


Alignment Length:309 Identity:72/309 - (23%)
Similarity:126/309 - (40%) Gaps:78/309 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRAKLDGAP---ADGNTSAAAGNNEEESEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRK 66
            |.|.|....|   :|.|.:      |:|.:.|.::.....|...|:.....:|..:|:||.....
  Fly     9 PPRMKYTAPPKMESDLNFT------EKEKKTLTELKQLYLETINLDVALQRDIYNIEKKYEDKHN 67

  Fly    67 PCYEKRSELV--------------KRIPNFWV-------TSFINHPQVSGILDEEEEECLHALNK 110
            ..::||.:::              :.:||||:       |.||:         :.:|:.|..|:.
  Fly    68 IIFDKRKKILDEFRKQNHGDVETNQSVPNFWLRVLKASYTEFIS---------KRDEKILECLSD 123

  Fly   111 LEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLN------SAAASENGDWPASTSTPIKWKE 169
            :....:.:....:.|.||||.|.||.|.||||.:.||      ...|.:..:........|.||:
  Fly   124 IRSRLYNEPVVKFDIEFHFDPNDYFTNTVLTKTYFLNCLPDPDDPLAYDGAEIYKCEGCVIDWKQ 188

  Fly   170 GKNLLKLLLTKPYGNKKKRNSEYKTFFDWFS------DNTDPVNDEIAELIKDDLWPNPLQYYL- 227
            .|            ::.|..::..:||::||      |..||...::..::::|.   .:.:|| 
  Fly   189 TK------------DQTKTENQEPSFFEFFSPPLLPEDTLDPNYCDVNAMLQNDF---EVGFYLK 238

  Fly   228 ---VPDIEV----EPEDEEDNEDNDEEAFDDEDGEDGEGEEEEEDEDDK 269
               :|...:    |..|.:.:..::.|:.|.||    |.:.||||..||
  Fly   239 ERVIPKAVIFFTGEIADCQSSSGSETESEDTED----ESDAEEEDGVDK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 48/228 (21%)
milNP_651592.2 NAP 37..251 CDD:279323 50/237 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456669
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.