DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and set

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_012823605.1 Gene:set / 394638 XenbaseID:XB-GENE-986872 Length:280 Species:Xenopus tropicalis


Alignment Length:268 Identity:155/268 - (57%)
Similarity:206/268 - (76%) Gaps:12/268 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AKLDGAPADGNTSAAAGNNE-EESEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEK 71
            ||:.....:.|...|...:| |:.||:|.||..|||||.|||:||||||||||||||||:|.::|
 Frog     6 AKVSKKEVNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQK 70

  Fly    72 RSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFE 136
            ||||:.:|||||||:|:||||||.:|.||:||.||.|.::||.|||||||||||:|:||||||||
 Frog    71 RSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFE 135

  Fly   137 NKVLTKEFHLNSAAASENGDWPASTSTPIKWKEGKNLLK-LLLTKPYGNKKKRNSEYKTFFDWFS 200
            ||||:||||||     |:|| |:|.||.||||.||:|.| ...|:...::|:::.|.::||.||:
 Frog   136 NKVLSKEFHLN-----ESGD-PSSKSTEIKWKAGKDLTKRSSQTQNKASRKRQHEEPESFFTWFT 194

  Fly   201 DNTDPVNDEIAELIKDDLWPNPLQYYLVPDIEVEPE--DEEDNEDNDEEAFD--DEDGEDGEGEE 261
            |::|...||:.|:||||:||||||||||||:|.|..  :|||::|.:||..:  ||:|::.|||.
 Frog   195 DHSDAGADELGEVIKDDIWPNPLQYYLVPDMEDEEAEGEEEDDDDEEEEGLEDIDEEGDEDEGEG 259

  Fly   262 EEEDEDDK 269
            |::|::|:
 Frog   260 EDDDDEDE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 127/196 (65%)
setXP_012823605.1 NAP 37..221 CDD:366386 122/189 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 197 1.000 Domainoid score I3052
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55707
Inparanoid 1 1.050 307 1.000 Inparanoid score I2592
OMA 1 1.010 - - QHG55441
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 1 1.000 - - oto105249
Panther 1 1.100 - - LDO PTHR11875
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R11118
SonicParanoid 1 1.000 - - X2181
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.