DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and TSPYL6

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001003937.2 Gene:TSPYL6 / 388951 HGNCID:14521 Length:410 Species:Homo sapiens


Alignment Length:246 Identity:75/246 - (30%)
Similarity:128/246 - (52%) Gaps:36/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRAKLDGAPADGNTSAAAGNNEEESEALEQI----------------------DACQNEIDALN 47
            |:...:..||.|........:..||:.|::::                      ::.|.|:|::|
Human   152 PEECAMFSAPVDEKPGGEEMDVAEENRAIDEVNREAGPGPGPGPLNVGLHLNPLESIQLELDSVN 216

  Fly    48 EKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLE 112
            .:|...:|:||:::.::.:...|:|:::::.||.||||:|.:|||:|.::..::.|.|..|..||
Human   217 AEADRALLQVERRFGQIHEYYLEQRNDIIRNIPGFWVTAFRHHPQLSAMIRGQDAEMLSYLTNLE 281

  Fly   113 VEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPASTSTPIKWKEGKNLLKLL 177
            |:|....::|.:..|.|..||||.||::.|.:.:.|...      ..|.||.|.|:.|..     
Human   282 VKELRHPRTGCKFKFFFQRNPYFRNKLIVKVYEVRSFGQ------VVSFSTLIMWRRGHG----- 335

  Fly   178 LTKPYGNKKKRNSEYKTFFDWFSDNTDPVNDEIAELIKDDLWPNPLQYYLV 228
               |.....:......:||.||||::.|.:|.||::||:|||.|||||||:
Human   336 ---PQSFIHRNRHVICSFFTWFSDHSLPESDRIAQIIKEDLWSNPLQYYLL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 67/217 (31%)
TSPYL6NP_001003937.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..69
NAP 205..382 CDD:298680 66/190 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152058
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.