DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and Nap1

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001246485.1 Gene:Nap1 / 37798 FlyBaseID:FBgn0015268 Length:370 Species:Drosophila melanogaster


Alignment Length:354 Identity:82/354 - (23%)
Similarity:142/354 - (40%) Gaps:110/354 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 APADGNTSAAAGNNEEESEA-------------------LEQI-----DACQN--------EIDA 45
            |||:|:....:.|..|:.::                   |:|:     ...||        ::..
  Fly     3 APAEGHVDPESCNEIEDEKSGSDCQSMPAYMNSVMRRQYLQQMVKMLPAPVQNRIVFLKNLQLQH 67

  Fly    46 LNEKAS--EEILKVEQKYNKLRKPCYEKRSELV-------------------------------- 76
            ||.:|.  |::.|:||||....:|.::||.|::                                
  Fly    68 LNIEAQFFEDVYKLEQKYQVQYQPLFDKRREIIEGKVDPAEEKPQWKEPESSTDNEADAEHFREA 132

  Fly    77 -----------KRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFD 130
                       |.||.||:|.|.|...:|.::...:|..:..|..:.::  .|....|.:.||||
  Fly   133 LSSLKSIPKDAKGIPGFWLTVFRNTAIMSEMVQPHDEPAIRKLIDISIK--YDNGHSYTLEFHFD 195

  Fly   131 ENPYFENKVLTKEFHLNSAA------ASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKK-- 187
            :|.||.|.||||::.|.|..      |.|..:....|...|.|::..||....:.|...:|::  
  Fly   196 KNEYFSNSVLTKQYVLKSTVDPNDPFAFEGPEIYKCTGCTINWEKKMNLTVKTIRKKQKHKERGA 260

  Fly   188 -----RNSEYKTFFDWFS-----DNTDPVND----------EIAELIKDDLWPNPLQYYLVPDI- 231
                 :.....:||::||     .:.:.|:|          ||...::..:.|..:.|| ..|| 
  Fly   261 VRTIVKQVPTDSFFNFFSPPEVPSDQEEVDDDSQQILATDFEIGHFLRARIIPKAVLYY-TGDIV 324

  Fly   232 -EVEPEDEEDNEDNDEEAFDDEDGEDGEG 259
             :.:.||||:.::|:|:.:||:|....:|
  Fly   325 DDEDDEDEEEYDENEEDEYDDDDAPPPKG 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 63/300 (21%)
Nap1NP_001246485.1 NAP 55..321 CDD:279323 61/268 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.