DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and seta

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_958883.1 Gene:seta / 323501 ZFINID:ZDB-GENE-030131-2221 Length:269 Species:Danio rerio


Alignment Length:245 Identity:151/245 - (61%)
Similarity:192/245 - (78%) Gaps:9/245 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NNEEESEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFIN 89
            :.:|:.||:|.||..|||||.|||:||||||||||||||||:|.::|||||:.:|||||||:|:|
Zfish    24 SEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVN 88

  Fly    90 HPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLNSAAASEN 154
            |||||.:|.||:||.||.|.::||.|||||||||||:|:||||.|||||||:||.|||     |:
Zfish    89 HPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENMYFENKVLSKEIHLN-----ES 148

  Fly   155 GDWPASTSTPIKWKEGKNLL-KLLLTKPYGNKKKRNSEYKTFFDWFSDNTDPVNDEIAELIKDDL 218
            || |.|.||.||||.||:|. :...|:....||:::.|.::||.||:|:.|...||:.|:||||:
Zfish   149 GD-PTSKSTEIKWKPGKDLTSRSSQTQSKAGKKRQHEEPESFFTWFTDHADSGADELGEVIKDDI 212

  Fly   219 WPNPLQYYLVPDIEVEPEDEEDNEDNDEEAFDDEDGEDGEGEEEEEDEDD 268
            ||||||||||||:|.| |.|.::||:|||..||.| |:|:.:.||||:||
Zfish   213 WPNPLQYYLVPDMEDE-EGEGEDEDDDEEGLDDID-EEGDDDGEEEDDDD 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 125/196 (64%)
setaNP_958883.1 NAP 37..221 CDD:279323 120/189 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 196 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 304 1.000 Inparanoid score I2633
OMA 1 1.010 - - QHG55441
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 1 1.000 - - otm24515
orthoMCL 1 0.900 - - OOG6_103113
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R11118
SonicParanoid 1 1.000 - - X2181
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.