DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and LOC317165

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001041357.1 Gene:LOC317165 / 317165 RGDID:1561581 Length:521 Species:Rattus norvegicus


Alignment Length:261 Identity:142/261 - (54%)
Similarity:184/261 - (70%) Gaps:10/261 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DGAPADGNTSAAAGNNEEESEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSEL 75
            :|.|.....|:......|:.||:|.||..|||||.|||:||||||||||||||||:|.::|||||
  Rat    20 EGKPKPVKRSSNQDGVNEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSEL 84

  Fly    76 VKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVL 140
            :.:||:|.||:|:||||||.:|:||.||.|..|.::||.||||||||||::|:||||||||||||
  Rat    85 IAKIPDFRVTTFVNHPQVSVLLEEEVEEALLYLTRVEVTEFEDIKSGYRVDFYFDENPYFENKVL 149

  Fly   141 TKEFHLNSAAASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYKTFFDWFSDNTDP 205
            :||||||     ||.|. :|..|.||||.||:|.|..........:||..|....|.|.:|.:|.
  Rat   150 SKEFHLN-----ENDDL-SSKFTEIKWKSGKDLTKRSSQTQNKASRKRQREEPESFTWLTDRSDA 208

  Fly   206 VNDEIAELIKDDLWPNPLQYYLVPDI-EVEPEDEEDNEDNDEEAFD--DEDGEDGEGEEEEEDED 267
            ..||:.|:|||.:|.|.||||||||: :.|.|.|:|::|.:||..:  ||:|::.|| ||::|||
  Rat   209 GADELREVIKDGIWSNSLQYYLVPDMDDEEGEAEDDDDDEEEEGLENTDEEGDEDEG-EEDDDED 272

  Fly   268 D 268
            :
  Rat   273 E 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 116/195 (59%)
LOC317165NP_001041357.1 NAP 47..230 CDD:298680 111/188 (59%)
DUF1725 411..>425 CDD:285525
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8286
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 1 1.000 - - otm46292
orthoMCL 1 0.900 - - OOG6_103113
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2181
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.920

Return to query results.
Submit another query.