DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and Tspyl5

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_006241581.1 Gene:Tspyl5 / 314555 RGDID:1311262 Length:410 Species:Rattus norvegicus


Alignment Length:257 Identity:87/257 - (33%)
Similarity:140/257 - (54%) Gaps:41/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RAKLDGAPADGN----TSAAAGNNEEESE------------ALEQIDACQNEIDALNEKASEEIL 55
            :|.:.|.|..|:    .:|..|..::.:|            :::.::..|.:::.:|.:|....|
  Rat   154 QATVSGKPKMGSARPCAAAPVGEEKKVTEKHAGSGSPAAVGSMDTLETVQLKLETMNAQADRAYL 218

  Fly    56 KVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIK 120
            ::.:|:.:||....|:|:.|::.||.||..:|.||||:|..|:.:::|.|..||:|||||....:
  Rat   219 RLSRKFGQLRLHHLERRNLLIQSIPGFWGQAFQNHPQLSSFLNTKDKEVLSYLNRLEVEELGLAR 283

  Fly   121 SGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPA----STSTPIKWKEGKNLLKLLLTKP 181
            .||:|.|:|..||||:||||.||:          |..|:    |.|.||:|..|.:|..|....|
  Rat   284 LGYKIKFYFGRNPYFQNKVLIKEY----------GCGPSGQVVSRSAPIQWLPGHDLQSLSKENP 338

  Fly   182 YGNKKKRNSEYKTFFDWFSDNTDPVNDEIAELIKDDLWPNPLQYYLVPDIEVEPEDEEDNED 243
            ..|        .:||.|||:::...:|:|.|:|.:|||||||||||:.:   |...|:..|:
  Rat   339 ENN--------GSFFGWFSNHSSIESDKIVEIINEDLWPNPLQYYLISE---EAHGEKGKEE 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 76/211 (36%)
Tspyl5XP_006241581.1 NAP 217..367 CDD:298680 63/167 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345557
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.