DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and CG3708

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_569871.2 Gene:CG3708 / 31039 FlyBaseID:FBgn0040345 Length:362 Species:Drosophila melanogaster


Alignment Length:246 Identity:54/246 - (21%)
Similarity:97/246 - (39%) Gaps:63/246 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEE 115
            :||:.::.||...:        |.....:|.||:|.|.|.|.:|.::.:.:|..|.:|..:.:..
  Fly   145 NEELRQLRQKLAPV--------SPTTLGVPRFWLTVFQNVPLLSELVQDHDEPLLESLMDVRLAY 201

  Fly   116 FEDIKSGYRINFHFDENPYFENK--VLTKEFHLNSAAASENGDWPASTSTP---------IKWKE 169
            .:|   .|.:.|.|..|.:..:.  :|||.:.|..:|..|   :|.....|         |.|::
  Fly   202 DQD---SYMVIFQFRPNSFLHDSSLLLTKRYFLQHSADPE---YPFLFEGPEIVRCEGCHIHWRD 260

  Fly   170 GKNLLKLLLTKPYGNKKKRNSEYK--------TFFDWFS-----------DNTDPV--ND-EIAE 212
            |.|     ||......::||..::        :||.:|:           :.|..:  || |:..
  Fly   261 GSN-----LTLQTVESRRRNRAHRVTKVMPRESFFRFFAPPQALDLSLADEKTKLILGNDFEVGF 320

  Fly   213 LIKDDLWPNPLQYYLVPDIEVEPEDEEDNEDNDEEAFDDEDGEDGEGEEEE 263
            |::..:.|..:.:|           ..|..|:...|..|......|.|:|:
  Fly   321 LLRTQIVPKAVLFY-----------TGDLVDSLSAASPDSRSLSSEAEQEQ 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 46/208 (22%)
CG3708NP_569871.2 NAP 71..336 CDD:279323 47/220 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456667
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.