DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and Tspyl4

DIOPT Version :10

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001012075.1 Gene:Tspyl4 / 309828 RGDID:1306653 Length:407 Species:Rattus norvegicus


Alignment Length:227 Identity:75/227 - (33%)
Similarity:129/227 - (56%) Gaps:25/227 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AAGNNEEE--------SEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKR 78
            |||..::|        :..::.::|...|:..:|.:|....|::|:|:.::|:...::||.:::.
  Rat   178 AAGGGKDETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLERKFGRMRRLHMQRRSFIIQN 242

  Fly    79 IPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKE 143
            ||.||||:|.||||:|.::..::|:.:..:..|||||.:..::|.:..|.|..||||.|:.|.||
  Rat   243 IPGFWVTAFRNHPQLSPMISGQDEDMMRYMINLEVEELKHPRAGCKFKFIFQSNPYFRNEGLVKE 307

  Fly   144 FHLNSAAASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYKTFFDWFSDNTDPVND 208
            :...|:..      ..|.||||:|..|:.      .:.:.::.:..:...:||:||||::....|
  Rat   308 YERRSSGR------VVSLSTPIRWHRGQE------PQAHIHRNREGNTIPSFFNWFSDHSLLEFD 360

  Fly   209 EIAELIKDDLWPNPLQYYLVPD-----IEVEP 235
            .|||:||.:||.|||||||:.|     :.|.|
  Rat   361 RIAEIIKGELWSNPLQYYLMGDGPRRGVRVPP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:460010 66/195 (34%)
Tspyl4NP_001012075.1 PTZ00007 219..379 CDD:471807 62/171 (36%)

Return to query results.
Submit another query.