DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and Tspyl4

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001012075.1 Gene:Tspyl4 / 309828 RGDID:1306653 Length:407 Species:Rattus norvegicus


Alignment Length:227 Identity:75/227 - (33%)
Similarity:129/227 - (56%) Gaps:25/227 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AAGNNEEE--------SEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKR 78
            |||..::|        :..::.::|...|:..:|.:|....|::|:|:.::|:...::||.:::.
  Rat   178 AAGGGKDETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLERKFGRMRRLHMQRRSFIIQN 242

  Fly    79 IPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKE 143
            ||.||||:|.||||:|.::..::|:.:..:..|||||.:..::|.:..|.|..||||.|:.|.||
  Rat   243 IPGFWVTAFRNHPQLSPMISGQDEDMMRYMINLEVEELKHPRAGCKFKFIFQSNPYFRNEGLVKE 307

  Fly   144 FHLNSAAASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYKTFFDWFSDNTDPVND 208
            :...|:..      ..|.||||:|..|:.      .:.:.::.:..:...:||:||||::....|
  Rat   308 YERRSSGR------VVSLSTPIRWHRGQE------PQAHIHRNREGNTIPSFFNWFSDHSLLEFD 360

  Fly   209 EIAELIKDDLWPNPLQYYLVPD-----IEVEP 235
            .|||:||.:||.|||||||:.|     :.|.|
  Rat   361 RIAEIIKGELWSNPLQYYLMGDGPRRGVRVPP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 66/195 (34%)
Tspyl4NP_001012075.1 NAP 219..379 CDD:298680 62/171 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345563
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.