DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and RGD1563307

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_218493.2 Gene:RGD1563307 / 308503 RGDID:1563307 Length:273 Species:Rattus norvegicus


Alignment Length:266 Identity:145/266 - (54%)
Similarity:195/266 - (73%) Gaps:15/266 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AKLDGAPADGNTSAAAGNNE-EESEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEK 71
            ||......:.|...|...:| |:.||:|.|...|||||.|||:||||:||||||.||||:|.::|
  Rat     6 AKASKKELNSNHDGADKTSEKEQQEAIEHIGKVQNEIDRLNEQASEEVLKVEQKCNKLRQPFFQK 70

  Fly    72 RSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFE 136
            ||||:.::|.||||:||||||||..|.||:||.||.|.::||.|||||||||.|:|:||||||||
  Rat    71 RSELIAKVPKFWVTTFINHPQVSAFLAEEDEEALHYLTRVEVREFEDIKSGYGIDFYFDENPYFE 135

  Fly   137 NKVLTKEFHLNSAAASENGDWPASTSTPIKWKEGKNLLK-LLLTKPYGNKKKRNSEYKTFFDWFS 200
            ||||:||||||     |:|| |:|.||.||||.||:|.| ...|:....:|:::.|.::||.||:
  Rat   136 NKVLSKEFHLN-----ESGD-PSSKSTEIKWKSGKDLTKRSSQTQIKARRKRQHEEPESFFTWFT 194

  Fly   201 DNTDPVNDEIAELIKDDLWPNPLQYYLVPDIEVEPEDEEDNEDNDEEAFDDEDG-ED-GEGEEEE 263
            |::|...|::.|.||||:|||||||||.|::     |.|:.|.:|::.:|:|:| || .||:|:|
  Rat   195 DHSDADADDLGEAIKDDIWPNPLQYYLFPNM-----DNEEGEADDDDDYDEEEGLEDTDEGDEDE 254

  Fly   264 EDEDDK 269
            :|:|::
  Rat   255 DDDDEE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 121/196 (62%)
RGD1563307XP_218493.2 NAP 37..221 CDD:279323 117/189 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 197 1.000 Domainoid score I3009
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 309 1.000 Inparanoid score I2531
OMA 1 1.010 - - QHG55441
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 1 1.000 - - otm46292
orthoMCL 1 0.900 - - OOG6_103113
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2181
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.