DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and Tspy26

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001099997.1 Gene:Tspy26 / 296280 RGDID:1310192 Length:334 Species:Rattus norvegicus


Alignment Length:196 Identity:63/196 - (32%)
Similarity:113/196 - (57%) Gaps:14/196 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHPQVSGIL 97
            ::.::|.|.|.:.::.::....|::.:::.::|:....:||.:::.||.||||:|:||||:|.::
  Rat   125 VDPLEAIQWEFEVMSAQSDGAHLQLVRRFERMRRLHLARRSFIIQNIPGFWVTAFLNHPQLSAMI 189

  Fly    98 DEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPASTS 162
            ...:|:.|..|..|||.|....::|.:..|.|..||||.|:|:.||:...|:..      ..:.:
  Rat   190 SPRDEDMLGYLMNLEVRELRHTRTGCKFKFLFGSNPYFRNEVIVKEYECRSSGR------VVAIA 248

  Fly   163 TPIKWKEGKNLLKLLLTKPYGNKKKRNSEYKTFFDWFSDNTDPVNDEIAELIKDDLWPNPLQYYL 227
            |.|:|..|:        :|.....:.....::||.|||.::....|.:|:::|||||||||||||
  Rat   249 TRIRWHRGQ--------EPPALVHRNRDTMRSFFSWFSQHSLLEADRVAQILKDDLWPNPLQYYL 305

  Fly   228 V 228
            :
  Rat   306 L 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 61/193 (32%)
Tspy26NP_001099997.1 NAP 174..305 CDD:298680 52/144 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345567
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.