DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and Tspyl1

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001013051.1 Gene:Tspyl1 / 29544 RGDID:1307726 Length:379 Species:Rattus norvegicus


Alignment Length:217 Identity:79/217 - (36%)
Similarity:122/217 - (56%) Gaps:24/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AAAGNNEEESEA----------LEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSEL 75
            |:.|..|.:.||          ...::|.|.|:|.:|.:|......:|||:.::|:...|:|:.:
  Rat   149 ASGGAREAQEEAGPWHLGIDLRTNPLEAIQLELDTVNAQADRAFQHLEQKFGRMRRHYLERRNYI 213

  Fly    76 VKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVL 140
            ::.||.||:|:|.||||:|.::..::.|.|..:..|||:|....|:|.:..|.|..||||.||::
  Rat   214 IQNIPGFWMTAFRNHPQLSAMIRGQDAEMLRYITNLEVKELRHPKTGCKFKFFFRRNPYFRNKLI 278

  Fly   141 TKEFHLNSAAASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYKTFFDWFSDNTDP 205
            .||:.:.|:..      ..|.||||.|:.|.        :|....::......:||.||||::.|
  Rat   279 VKEYEVRSSGR------VVSLSTPIIWRSGH--------EPQSFIRRNRDLICSFFTWFSDHSVP 329

  Fly   206 VNDEIAELIKDDLWPNPLQYYL 227
            .:|.|||:||:|||||||||||
  Rat   330 ESDRIAEIIKEDLWPNPLQYYL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 74/205 (36%)
Tspyl1NP_001013051.1 NAP 170..351 CDD:279323 72/194 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345566
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.