DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and nap1

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_587838.1 Gene:nap1 / 2539538 PomBaseID:SPCC364.06 Length:393 Species:Schizosaccharomyces pombe


Alignment Length:388 Identity:94/388 - (24%)
Similarity:142/388 - (36%) Gaps:143/388 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KRA-KLDGAPADGNT-SAAAGNN-----------EEESEALEQID-------------------A 38
            ||| |:..||...|| |..:..|           :|..|.||.||                   |
pombe    10 KRAGKMSAAPTPHNTPSGTSAPNFGAKAPQVNTIDEGDENLEAIDGKLGSLLHLTSEGVSELPEA 74

  Fly    39 CQNEIDA----------LNEKASEEILKVEQKYNKLRKPCYEKRSELV----------------- 76
            .|..|..          |..:..:|:.::|:.|.|...|.:::|||:|                 
pombe    75 VQRRISGLRGLQKRYSDLESQFQKELFELEKAYAKKYAPIFKRRSEVVRGADEPTEEEIKKGEAA 139

  Fly    77 ----------------------KRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDI 119
                                  |.||.||:|:..|...:|.::..|:|..|..|..:.:...|  
pombe   140 DENEKKEPTSSESKKQEGGDDTKGIPEFWLTAMKNVLSLSEMITPEDEGALSHLVDIRISYME-- 202

  Fly   120 KSGYRINFHFDENPYFENKVLTKEFHLNSAAASEN--------GDWPASTSTPIKWKEGKNLLKL 176
            |.|:::.|.|.|||:|.||:|||.::....:...|        ||       .:.|||..:|...
pombe   203 KPGFKLEFEFAENPFFTNKILTKTYYYMEESGPSNVFLYDHAEGD-------KVDWKENADLTVR 260

  Fly   177 LLTKPYGNKKKRNSEY-------KTFFDWFSDNTDPVN----------DEIAEL-------IKDD 217
            .:||...||..:.:..       .:||::|:..|.|..          ||:.||       .|:.
pombe   261 TVTKKQRNKNTKQTRVVKVSVPRDSFFNFFNPPTPPSEEDEESESPELDELLELDYQIGEDFKEK 325

  Fly   218 LWPNPLQYYL-----------VPDIEVEPEDEEDNEDNDEEAFDDEDGEDGEGEEEEEDEDDK 269
            |.|..::::.           ..|::|| |||:|.|.:..|...|.|         |||.|.|
pombe   326 LIPRAVEWFTGEALALENYDGFSDLDVE-EDEDDVESSSNEEVSDSD---------EEDSDSK 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 67/295 (23%)
nap1NP_587838.1 NAP 77..336 CDD:279323 60/267 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.