DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and Tspy1

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_075212.2 Gene:Tspy1 / 25223 RGDID:3912 Length:334 Species:Rattus norvegicus


Alignment Length:209 Identity:68/209 - (32%)
Similarity:112/209 - (53%) Gaps:22/209 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AAGNNEEESEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTS 86
            :.|...|....:|:::..|.|:..:|.:.|....:::.|..|:|:|.:::|..:::.||.||..:
  Rat   138 SGGGPAERRSKMEELELLQLELSFVNARCSGAFARIKAKVAKMRRPHFDRRKTIIQGIPGFWAKA 202

  Fly    87 FINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLNSAAA 151
            .:||||:|.|:..::|:.|..:..|||||:.......|:.|.|.|||||.|.::||::.|:....
  Rat   203 MMNHPQMSSIISNQDEDLLSYMLSLEVEEYNPGLRMCRMMFFFSENPYFRNDIVTKDYQLSIIGY 267

  Fly   152 SENGDWPASTSTPIKW----KEGKNLLKLLLTKPYGNKKKRNSEYKTFFDWFSDNTDPVNDEIAE 212
            .|      |.|:.|:|    :.|           |.|..:..:.. |||:|...:..|.::.|||
  Rat   268 KE------SDSSTIEWIGQAEHG-----------YANCMQDTTRL-TFFNWLCAHKFPGSNRIAE 314

  Fly   213 LIKDDLWPNPLQYY 226
            :|.||||||||.||
  Rat   315 IIMDDLWPNPLYYY 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 66/200 (33%)
Tspy1NP_075212.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..146 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345565
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.