DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and Tspyl3

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_941019.2 Gene:Tspyl3 / 241732 MGIID:2139328 Length:334 Species:Mus musculus


Alignment Length:263 Identity:78/263 - (29%)
Similarity:129/263 - (49%) Gaps:50/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSVPKRAKLDGA-PADGNTSAAAG-----NNEEESEALEQ------------------------- 35
            :|..:...|||. ...||.....|     ..||:|.|.|:                         
Mouse    58 NSASRVLNLDGCEKGSGNGVGTKGKTEEVTTEEDSVAAEEPAEVGEKLEWVAEAQESLRPLDLRA 122

  Fly    36 -----IDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHPQVSG 95
                 ::|.|.|::|::.:|....|::.:::.::|:....:||.:::.||.||||:|:||||:|.
Mouse   123 LIVDPLEAIQWELEAMSAQADGAHLQLVRRFGRMRRLHLARRSFIIQNIPGFWVTAFLNHPQLSA 187

  Fly    96 ILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPAS 160
            ::...:|:.|..|..|||.|....::|.:..|.|:.||||.|:|:.||:...::..      ..|
Mouse   188 MISPRDEDMLGYLMNLEVRELRHSRTGCKFKFLFESNPYFRNEVIVKEYECRASGG------VVS 246

  Fly   161 TSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYKTFFDWFSDNTDPVNDEIAELIKDDLWPNPLQY 225
            .:|.|.|..|:        :|.....:.....::||.|||.::....|.:|::||||||||||||
Mouse   247 IATRILWHRGQ--------EPPALVHRNRDAVRSFFSWFSQHSLLEADRVAQIIKDDLWPNPLQY 303

  Fly   226 YLV 228
            ||:
Mouse   304 YLL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 66/225 (29%)
Tspyl3NP_941019.2 NAP 174..305 CDD:298680 53/144 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842145
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.