DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and Tspyl5

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001078890.1 Gene:Tspyl5 / 239364 MGIID:2442458 Length:406 Species:Mus musculus


Alignment Length:257 Identity:89/257 - (34%)
Similarity:138/257 - (53%) Gaps:41/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RAKLDGAP--ADGNTSAAAGNNEEES--------------EALEQIDACQNEIDALNEKASEEIL 55
            :|.:.|.|  |.....|||...||:.              .:::.::..|.:::.:|.:|....|
Mouse   154 QATVSGKPKMASAGLCAAAPVGEEKKMTEKHAGAGSPATVGSMDTLETVQLKLETMNAQADRAYL 218

  Fly    56 KVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIK 120
            ::.:|:.:||....|:|:.|::.||.||..:|.||||:|..|:.:::|.|..||:|||||....:
Mouse   219 RLSRKFGQLRLHHLERRNLLIQSIPGFWGQAFQNHPQLSAFLNTKDKEVLSYLNRLEVEELGLAR 283

  Fly   121 SGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPA----STSTPIKWKEGKNLLKLLLTKP 181
            .||:|.|:|..||||:||||.||:          |..|:    |.|.||:|..|.:|..|....|
Mouse   284 LGYKIKFYFGRNPYFQNKVLIKEY----------GCGPSGQVVSRSAPIQWLPGHDLQSLSKENP 338

  Fly   182 YGNKKKRNSEYKTFFDWFSDNTDPVNDEIAELIKDDLWPNPLQYYLVPDIEVEPEDEEDNED 243
            ..|        .:||.|||:::...:|:|.|:|.:|||||||||||:.:   |...|:..|:
Mouse   339 ENN--------GSFFGWFSNHSSIESDKIVEIINEDLWPNPLQYYLISE---EARGEKGKEE 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 75/199 (38%)
Tspyl5NP_001078890.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..164 3/9 (33%)
NAP 217..367 CDD:298680 63/167 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..406 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842138
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.