DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and Tspyl1

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_033459.1 Gene:Tspyl1 / 22110 MGIID:1298395 Length:379 Species:Mus musculus


Alignment Length:249 Identity:84/249 - (33%)
Similarity:127/249 - (51%) Gaps:48/249 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 APADGNTSAAAGNNE----------EESEALE------------------------QIDACQNEI 43
            |.|:.:..|..|:.|          ||.|.||                        .::|.|.|:
Mouse   117 AAAEKSEVATPGSEEVMEVEQKPAGEEMEMLEASGGVREAPEEAGPWHLGIDLRRNPLEAIQLEL 181

  Fly    44 DALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHAL 108
            |.:|.:|......:|||:.::|:...|:|:.:::.||.||:|:|.||||:|.::...:.|.|..:
Mouse   182 DTVNAQADRAFQHLEQKFGRMRRHYLERRNYIIQNIPGFWMTAFRNHPQLSAMIRGRDAEMLRYV 246

  Fly   109 NKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPASTSTPIKWKEGKNL 173
            ..|||:|....|:|.:..|.|..||||.||::.||:.:.|:..      ..|.||||.|:.|.  
Mouse   247 TSLEVKELRHPKTGCKFKFFFRRNPYFRNKLIVKEYEVRSSGR------VVSLSTPIIWRRGH-- 303

  Fly   174 LKLLLTKPYGNKKKRNSEYKTFFDWFSDNTDPVNDEIAELIKDDLWPNPLQYYL 227
                  :|....::......:||.||||::.|.:|.|||:||:|||||||||||
Mouse   304 ------EPQSFIRRNQDLICSFFTWFSDHSLPESDRIAEIIKEDLWPNPLQYYL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 75/219 (34%)
Tspyl1NP_033459.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..134 5/16 (31%)
NAP 174..351 CDD:298680 72/190 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842144
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191764at2759
OrthoFinder 1 1.000 - - FOG0000644
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.