DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and Nap1l2

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_032697.2 Gene:Nap1l2 / 17954 MGIID:106654 Length:460 Species:Mus musculus


Alignment Length:274 Identity:67/274 - (24%)
Similarity:113/274 - (41%) Gaps:77/274 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DGNTSAAAGNNEEESEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIP 80
            ||........::||.|        :.|.|:......||:                 ..|..|.||
Mouse   202 DGYEDCYYDYDDEEEE--------EEEDDSAGATGGEEV-----------------NEEDPKGIP 241

  Fly    81 NFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKS-GYRINFHFDENPYFENKVLTKEF 144
            :||:|...|...::.::.:.:|..|..|..::|:..:..:. .:.:.|||..|.||:|::|||.:
Mouse   242 DFWLTVLKNVEALTPMIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNELLTKTY 306

  Fly   145 HLNSAAASENGDWP---------ASTSTPIKWKEGKNL-LKLLLTKPYGNKKKRNSEYKT----- 194
            .|.|..|..:   |         .:|...|.|.||||: |:.:      .||:|:..:.|     
Mouse   307 VLKSKLACYD---PHPYRGTAIEYATGCDIDWNEGKNVTLRTI------KKKQRHRVWGTVRTVT 362

  Fly   195 -------FFDWFSDNTDPVN--DEIAELIKDD-LWPNPLQYYLVP---------DIEVEPED--- 237
                   ||::||.:...:|  ||     .|| |..:.|:.|::|         .:|.:.|.   
Mouse   363 EDFPKDSFFNFFSPHGISLNGGDE-----NDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGVVR 422

  Fly   238 EEDNEDNDEEAFDD 251
            |.::|..|:..:||
Mouse   423 EVNDEIYDKIIYDD 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 54/221 (24%)
Nap1l2NP_032697.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..87
NAP 111..410 CDD:279323 60/246 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..238 8/49 (16%)
Nuclear localization signal. /evidence=ECO:0000255 346..352 2/11 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842141
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.