DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and Nap1l3

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_596893.1 Gene:Nap1l3 / 170914 RGDID:620990 Length:536 Species:Rattus norvegicus


Alignment Length:277 Identity:56/277 - (20%)
Similarity:109/277 - (39%) Gaps:85/277 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EEESEALEQIDACQNEIDALNE-----------------------KASEEI--LKVEQKYNKLR- 65
            ||::::.:.||....|.:.|.:                       :|.:.:  .:.|::.|..| 
  Rat   264 EEKTDSTDCIDIAPEEKEDLKDVTQANAEYTDQPTEDSTPRAPVREAQKRVPETRPEERVNIKRA 328

  Fly    66 ---KPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKS--GYRI 125
               ||   |:.:..:.||::|:|...|..::..::.:.:|..|..|:.:.: :|.:...  .|..
  Rat   329 RKGKP---KKEDPPRGIPDYWLTVLKNVDKLGPMIQKCDEPILKFLSDVSL-KFSNPGQPISYTF 389

  Fly   126 NFHFDENPYFENKVLTKEFHLNSAAASENGD------WPAS--TSTPIKWKEGKNLLKLLLTKPY 182
            .|||..||||.|::|.|.:.:.|  ..::.|      |...  ....|.|:.||::.....::| 
  Rat   390 EFHFLPNPYFRNELLMKTYIIRS--KPDHYDPFFAWGWEIEECKGCKIDWRRGKDVTVTTRSRP- 451

  Fly   183 GNKKKRNSEYKTFFDWFSDNTDPVNDEIAELIKDDLWPNP--LQYYLVPDI----EVEPEDEEDN 241
                                  .:..||.  ::..:.||.  ..::..|:|    ::||:     
  Rat   452 ----------------------AITGEIE--VQPRVVPNASFFNFFSPPEIPLIGKLEPK----- 487

  Fly   242 EDNDEEAFDDEDGEDGE 258
                |:|..|||.|.|:
  Rat   488 ----EDAILDEDFEIGQ 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 43/236 (18%)
Nap1l3NP_596893.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104
NAP 109..>149 CDD:298680
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..338 13/76 (17%)
eIF3_subunit 204..>266 CDD:285763 1/1 (100%)
NAP 345..516 CDD:279323 41/193 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.