DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and AgaP_AGAP009639

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_318672.4 Gene:AgaP_AGAP009639 / 1279015 VectorBaseID:AGAP009639 Length:384 Species:Anopheles gambiae


Alignment Length:251 Identity:58/251 - (23%)
Similarity:101/251 - (40%) Gaps:58/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NNEEESEALEQIDACQNEIDAL-NEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVT--- 85
            :|...::|.:|...|.::|..: |.....|:.:        ..|.....::....:|.||:|   
Mosquito   126 SNPTPNDAADQPTGCHDKIARIVNGLDVPELTE--------SNPAPNDAADQPTGVPEFWLTVLK 182

  Fly    86 -SFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLNSA 149
             ||:.|     ::.:.:|..|..|..:.|....:...|:.:.|.|..|.||.|:||:|::.|..|
Mosquito   183 SSFLGH-----MIQKRDEPVLKQLQDIRVVLVSEPVPGFELLFSFAPNEYFANEVLSKKYFLRCA 242

  Fly   150 AASENGDWP---------ASTSTPIKWKEGKNLLKLLLTKPYGNKKK--RNS--------EYKTF 195
               .|.|.|         :.....|.||:|.||::    .|..:.:.  |.|        ...:|
Mosquito   243 ---PNPDAPVMFDGFEIYSCEGCTIDWKDGHNLVE----APGSSWRSSIRRSLPSVTTRLPASSF 300

  Fly   196 FDWFS----DNTD---PVNDEIAEL-------IKDDLWPNPLQYYLVPDIEVEPED 237
            ||:|:    .|.|   ..|:.|.|.       ||:.:.|..:..:|..:|.:..|:
Mosquito   301 FDFFNPESMTNADYDADFNEAIMECDFQYGYHIKETIIPRAVFLFLKENINLGDEN 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 54/233 (23%)
AgaP_AGAP009639XP_318672.4 NAP 71..346 CDD:279323 55/239 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.