DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set and HSF5

DIOPT Version :9

Sequence 1:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_011522585.1 Gene:HSF5 / 124535 HGNCID:26862 Length:603 Species:Homo sapiens


Alignment Length:216 Identity:45/216 - (20%)
Similarity:75/216 - (34%) Gaps:72/216 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DGNTSAAAGNNEEESEALEQIDACQNEIDALNEKASEEILKVEQKYNKL---------------- 64
            |.||     ..|...||:.||      :|.|:.....|::|||...|:.                
Human   370 DENT-----KTEVNLEAVFQI------VDELHSSPKLEMVKVEPVENQCPTSPSYRGQHILANSN 423

  Fly    65 -RKPC-YEKRSELVKRIP-NFWVTSFI--NHPQVSGILDEEEE--ECLHALNKLE---VEEFEDI 119
             ..|| ..:.|:|....| ...:.||:  ....|:..|.:..|  ..:|....:|   ::|...|
Human   424 NSNPCSASQASQLEPLTPVGSDIMSFVVGTEQAVACSLPQSPEYIYTIHTAQPVENSTIQESAAI 488

  Fly   120 KSGY-RINFHFDENPYFENKVLTKE---FHLNSAAA----------------------SENGDWP 158
            :..: ::..|.:.||...:.|..:|   |..:...|                      ||.|  |
Human   489 QQAHVKLKEHLNHNPSPSSVVFVQEGPPFSTHQVDANIKCQTSSRENILPSEQMGFLISEMG--P 551

  Fly   159 AS-------TSTPIKWKEGKN 172
            ||       .:||.:::|.::
Human   552 ASKPSEDTGLATPARYREHRS 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SetNP_650438.2 NAP 31..227 CDD:279323 41/201 (20%)
HSF5XP_011522585.1 HSF_DNA-bind 20..129 CDD:278854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.