DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2gamma and eef1a2

DIOPT Version :9

Sequence 1:NP_001262587.1 Gene:eIF2gamma / 41843 FlyBaseID:FBgn0263740 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001002371.1 Gene:eef1a2 / 436644 ZFINID:ZDB-GENE-040718-64 Length:463 Species:Danio rerio


Alignment Length:365 Identity:84/365 - (23%)
Similarity:135/365 - (36%) Gaps:123/365 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 INIGTIGHVAHGKST----VVKAISGV--QTV----------------------RFKNELERNIT 77
            |||..||||..||||    ::....|:  :|:                      :.|.|.||.||
Zfish     8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGIT 72

  Fly    78 IKLGYANAKIYKCDNPKCPRPASFVSDASSKDDSLPCTRLNCSGNFRLVRHVSFVDCPGHDILMA 142
            |.:     .::|.:..|                                .:::.:|.|||...:.
Zfish    73 IDI-----SLWKFETTK--------------------------------YYITIIDAPGHRDFIK 100

  Fly   143 TMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKQILILQNKIDLIKESQAKE 201
            .|:.|.:..|.|:|::|....      ....||.||......:.:||:::..||:|..:.|.:::
Zfish   101 NMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVAVNKMDSTEPSYSEK 165

  Fly   202 QYEEITKFVQGTVAE------GAPIIPISA-----QLK----------YNID---------VLCE 236
            :|:||.|.|...:.:      ..|.:|||.     .|:          :.:|         .|.|
Zfish   166 RYDEIVKEVSAYIKKIGYSPASVPFVPISGWHGDNMLEPSSNMPWFKGWKLDRKEHHAGGVTLLE 230

  Fly   237 YIVNKIPVPPRDFNAPPRLIVIRSFDVNKPGCEVADLKGGVAGGSILSGVLKVGQEIEVRPGVVT 301
            .:...:| |.|..:.|.||.:   .||.|.|.     .|.|..|.:.:|||        ||.:|.
Zfish   231 ALDTIMP-PTRPTDKPLRLPL---QDVYKIGG-----IGTVPVGRVETGVL--------RPSMVV 278

  Fly   302 KDSDGNITCRPIFSRIVSLFAEQNELQYAVPGGLIGVGTK 341
            ..:..|||     :.:.|:......|..|:||..:|...|
Zfish   279 TFAPVNIT-----TEVKSVEMHHESLSEALPGDNVGFNVK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2gammaNP_001262587.1 PTZ00327 11..465 CDD:240362 84/365 (23%)
eef1a2NP_001002371.1 PTZ00141 1..460 CDD:185474 84/365 (23%)
EF1_alpha 9..238 CDD:206670 55/266 (21%)
EF1_alpha_II 242..332 CDD:293894 26/93 (28%)
EF1_alpha_III 336..438 CDD:294004
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592505
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.