DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2gamma and eEFSec

DIOPT Version :9

Sequence 1:NP_001262587.1 Gene:eIF2gamma / 41843 FlyBaseID:FBgn0263740 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_611584.1 Gene:eEFSec / 37444 FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster


Alignment Length:465 Identity:115/465 - (24%)
Similarity:187/465 - (40%) Gaps:122/465 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NIGTIGHVAHGKSTVVKAISGV-QTVRF-KN--ELERNITIKLGYANAKIYKCDNPKCPRPASFV 102
            |||.:|||..||:|:.||:|.: .|..| ||  .:||.||:.||::...:        ..||.. 
  Fly     6 NIGLLGHVDSGKTTLAKALSSISSTAAFDKNPQSVERGITLDLGFSGLLV--------DAPAHL- 61

  Fly   103 SDASSKDDSLPCTRLNCSGNFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQP 167
                .:.:.|..|               |||||||..|:.|::.||.::|..||::...:. .|.
  Fly    62 ----PQGEQLQFT---------------FVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKG-KQT 106

  Fly   168 QTSEHLAAIEIMKLKQILILQNKIDLIKESQAKEQYEE----ITKFVQGTVAEG-APIIPISAQL 227
            ||:|.|...|::: |:::::.||||:..|:|...:.|:    :.|.::.|...| .||..:||..
  Fly   107 QTAECLIIGELLQ-KKLIVVINKIDVYPENQRASKLEKLRLRLAKTLEATTFGGQVPICAVSALQ 170

  Fly   228 KYNIDVLCEYIVNKIPVPPRDFNAPPRLIVIRSFDVNKPGCEVADLKGGVAGGSILSGVLKVGQE 292
            ..:|..|.|.:......|.|:...|..:.|...|.:..        :|.|..|::|.|.::|...
  Fly   171 GTHIAELREVLREAYFQPQRNLADPLFMYVDHCFGIKG--------QGTVCTGTLLQGKVQVNNV 227

  Fly   293 IEVRPGVVTKDSDGNITCRPIFSRIVSLFAEQNELQYAVPGGLIGVGTKIDPTLC----RADRLV 353
            ||: |.:..:            .::.|:...:..:..|..|..||        ||    .|..|.
  Fly   228 IEL-PALGEQ------------RKVKSIQMFRKNVTSASMGDRIG--------LCVTQFNAKLLE 271

  Fly   354 GQVLGAVGQLPDIY----QELEISYY-----LLRRL--------------LGVRTDG-------D 388
            ..::...|.|..||    |...|.||     .:|::              |...|||       |
  Fly   272 RGIITQPGYLKPIYAVCLQFKPIRYYKEVIKSMRKMHISVGHNTVMANVTLFRDTDGTTSTFQLD 336

  Fly   389 KKGARVE-----KLQKNEILLVNIGSLSTGGRISATKGDLAKIVLTTPVCTEKGEKIALSRRVEN 448
            |:...:|     ::|.|:::...:              .....||:.|..|....|:.:... ..
  Fly   337 KEYEYMEDVQPAEVQHNDVIYALL--------------QFESPVLSPPHSTLIASKLDMDVH-ST 386

  Fly   449 HWRLIGWGQI 458
            ..||..||:|
  Fly   387 SCRLAFWGRI 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2gammaNP_001262587.1 PTZ00327 11..465 CDD:240362 115/465 (25%)
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 66/215 (31%)
SelB 6..467 CDD:225815 115/465 (25%)
SelB_II 196..278 CDD:293897 20/110 (18%)
eSelB_III 283..396 CDD:294009 25/127 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464579
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3276
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.