DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2gamma and Dgp-1

DIOPT Version :9

Sequence 1:NP_001262587.1 Gene:eIF2gamma / 41843 FlyBaseID:FBgn0263740 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_611302.1 Gene:Dgp-1 / 37080 FlyBaseID:FBgn0027836 Length:669 Species:Drosophila melanogaster


Alignment Length:448 Identity:84/448 - (18%)
Similarity:166/448 - (37%) Gaps:114/448 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 INIGTIGHVAHGKSTVVKAISGVQT---------------VRFKNELERNITIKLGYANAKIYKC 90
            |.:..:|:|..||||::    ||.|               .|.|:|:|...|..:|   ..|...
  Fly   144 IRVAVVGNVDAGKSTLL----GVLTHGELDNGRGHARQRLFRHKHEIESGRTSSVG---NDILGF 201

  Fly    91 DNPKCPRPASFVSDASSKDD--SLPCTRLNCSGNFRLVRHVSFVDCPGHDILMATMLNGAA--VM 151
            |.         |.:..:|.|  .|...:: |..:.::   ::|:|..||:..:.|.:.|..  ..
  Fly   202 DG---------VGNVVNKPDHGHLDWVKI-CENSAKV---ITFIDLAGHERYLKTTVFGMTGHAP 253

  Fly   152 DAALLLIAGNESCPQPQTSEHLAAIEIMKLKQILILQNKIDLIKESQAKEQYEEITKFVQGTVAE 216
            |..:|:|..|... ...|.||| .:.:.....:.::..|||:...:..:|..:.:.|.::.....
  Fly   254 DFGMLMIGANAGI-IGMTKEHL-GLALALAVPVFVVVTKIDMCPANVLQENMKLLFKMLKSQGCR 316

  Fly   217 GAPIIPISAQLKYNIDVL---CEYIVNKI-PVPPRDFNAPPRLIVIRSF----DVNKPGCE---- 269
            ..|::     ::.:.||:   ..::..:: |:..........|.:::.|    ....||.|    
  Fly   317 KVPVV-----VRSHDDVVLSATNFVSERLCPIFQVSNVTGDNLELLKMFLNLLSTRMPGSESLPA 376

  Fly   270 ---VADL-----KGGVAGGSILSGVLKVGQEIEVRPGVVTKDSDGN---ITCRPIFSRIVSL--- 320
               :.|:     .|.|..|:.|.|.:::...:.:.|     |:.|:   ||.:.|..:.:::   
  Fly   377 EFQIDDVYAVPGVGTVVSGTCLQGTIRLNDCLMLGP-----DAVGSFVPITIKSIHRKRMNVARV 436

  Fly   321 -------FAEQNELQYAVPGGLIGVGTKIDPTLCRADRLVGQVL------------------GAV 360
                   ||.:...:..:..|::.|...:.|..|.  ...|::|                  |::
  Fly   437 RCGQTASFALKKIKRAYLRKGMVMVSQDLKPQACW--EFEGEILVLHHPTTISARYQAMVHCGSI 499

  Fly   361 GQLPDIYQELEISYYLLRRLLGVRTDGDKKGARVEKLQKNEILLVNIGSLSTGGRISA 418
            .|...|   :.:|...||       .|||...:...:::.|.:......:...||..|
  Fly   500 RQTASI---IHMSRDCLR-------TGDKAHVKFRFIKQPEYIRAGQRLVFREGRTKA 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2gammaNP_001262587.1 PTZ00327 11..465 CDD:240362 84/448 (19%)
Dgp-1NP_611302.1 GTPBP1 38..555 CDD:227583 84/448 (19%)
GTPBP1_like 145..367 CDD:206728 47/248 (19%)
GTPBP_II 376..462 CDD:293895 15/90 (17%)
GTPBP_III 468..553 CDD:294007 16/92 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.