DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2gamma and EEF1A2

DIOPT Version :9

Sequence 1:NP_001262587.1 Gene:eIF2gamma / 41843 FlyBaseID:FBgn0263740 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001949.1 Gene:EEF1A2 / 1917 HGNCID:3192 Length:463 Species:Homo sapiens


Alignment Length:491 Identity:100/491 - (20%)
Similarity:173/491 - (35%) Gaps:181/491 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 INIGTIGHVAHGKST----VVKAISGV--QTV----------------------RFKNELERNIT 77
            |||..||||..||||    ::....|:  :|:                      :.|.|.||.||
Human     8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGIT 72

  Fly    78 IKLGYANAKIYKCDNPKCPRPASFVSDASSKDDSLPCTRLNCSGNFRLVRHVSFVDCPGHDILMA 142
            |.:     .::|.:..|                                .:::.:|.|||...:.
Human    73 IDI-----SLWKFETTK--------------------------------YYITIIDAPGHRDFIK 100

  Fly   143 TMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKQILILQNKIDLIKESQAKE 201
            .|:.|.:..|.|:|::|....      ....||.||......:.:||:::..||:|..:.:.:::
Human   101 NMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEK 165

  Fly   202 QYEEITKFVQGTVAE------GAPIIPISAQLKYNIDVLCEYIVNKIPVPPRDFNAPPRLIVIRS 260
            :|:||.|.|...:.:      ..|.:|||.   ::.|.:.|      |.|               
Human   166 RYDEIVKEVSAYIKKIGYNPATVPFVPISG---WHGDNMLE------PSP--------------- 206

  Fly   261 FDVNKP---GCEVADLKGGVAGGSILS-----------------------------GVLKVGQEI 293
               |.|   |.:|...:|..:|.|:|.                             |.:.||: :
Human   207 ---NMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGR-V 267

  Fly   294 E---VRPGVVTKDSDGNITCRPIFSRIVSLFAEQNELQYAVPGGLIGVG---------------- 339
            |   :|||:|...:..|||     :.:.|:......|..|:||..:|..                
Human   268 ETGILRPGMVVTFAPVNIT-----TEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCG 327

  Fly   340 -TKIDPTLCRADRLVGQV--LGAVGQLPDIYQELEISY--YLLRRLLGVRTDGDKKGARVEKLQK 399
             :|.||.. .|.:...||  |...||:...|..:...:  ::..:...::...|::..:  ||:.
Human   328 DSKSDPPQ-EAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGK--KLED 389

  Fly   400 NEILLVNIGSLSTGGRISATKGDLAKIVLTTPVCTE 435
            |.      .||.:|      ...:.::|...|:|.|
Human   390 NP------KSLKSG------DAAIVEMVPGKPMCVE 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2gammaNP_001262587.1 PTZ00327 11..465 CDD:240362 100/491 (20%)
EEF1A2NP_001949.1 PTZ00141 1..460 CDD:185474 100/491 (20%)
G1. /evidence=ECO:0000250 14..21 4/6 (67%)
G2. /evidence=ECO:0000250 70..74 2/3 (67%)
G3. /evidence=ECO:0000250 91..94 1/2 (50%)
G4. /evidence=ECO:0000250 153..156 2/2 (100%)
G5. /evidence=ECO:0000250 194..196 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..463
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.