DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2gamma and Eef1a1

DIOPT Version :9

Sequence 1:NP_001262587.1 Gene:eIF2gamma / 41843 FlyBaseID:FBgn0263740 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_787032.1 Gene:Eef1a1 / 171361 RGDID:67387 Length:462 Species:Rattus norvegicus


Alignment Length:367 Identity:85/367 - (23%)
Similarity:131/367 - (35%) Gaps:127/367 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 INIGTIGHVAHGKST----VVKAISGV--QTV----------------------RFKNELERNIT 77
            |||..||||..||||    ::....|:  :|:                      :.|.|.||.||
  Rat     8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGIT 72

  Fly    78 IKLGYANAKIYKCDNPKCPRPASFVSDASSKDDSLPCTRLNCSGNFRLVRHVSFVDCPGHDILMA 142
            |.:     .::|.:..|                                .:|:.:|.|||...:.
  Rat    73 IDI-----SLWKFETSK--------------------------------YYVTIIDAPGHRDFIK 100

  Fly   143 TMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKQILILQNKIDLIKESQAKE 201
            .|:.|.:..|.|:|::|....      ....||.||......:.:||:::..||:|..:...:::
  Rat   101 NMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQK 165

  Fly   202 QYEEITKFVQ------GTVAEGAPIIPISAQLKYNIDVLCEYIVNK------------------- 241
            :||||.|.|.      |...:....:|||.   :|.|.:.|...|.                   
  Rat   166 RYEEIVKEVSTYIKKIGYNPDTVAFVPISG---WNGDNMLEPSANMPWFKGWKVTRKDGSASGTT 227

  Fly   242 -------IPVPPRDFNAPPRLIVIRSFDVNKPGCEVADLKGGVAGGSILSGVLKVGQEIEVRPGV 299
                   |..|.|..:.|.||.:   .||.|.|.     .|.|..|.:.:||||        ||:
  Rat   228 LLEALDCILPPTRPTDKPLRLPL---QDVYKIGG-----IGTVPVGRVETGVLK--------PGM 276

  Fly   300 VTKDSDGNITCRPIFSRIVSLFAEQNELQYAVPGGLIGVGTK 341
            |...:..|:|     :.:.|:......|..|:||..:|...|
  Rat   277 VVTFAPVNVT-----TEVKSVEMHHEALSEALPGDNVGFNVK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2gammaNP_001262587.1 PTZ00327 11..465 CDD:240362 85/367 (23%)
Eef1a1NP_787032.1 PTZ00141 1..460 CDD:185474 85/367 (23%)
G1. /evidence=ECO:0000250 14..21 4/6 (67%)
G2. /evidence=ECO:0000250 70..74 2/3 (67%)
G3. /evidence=ECO:0000250 91..94 1/2 (50%)
G4. /evidence=ECO:0000250 153..156 2/2 (100%)
G5. /evidence=ECO:0000250 194..196 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350763
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.