DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42404 and DGCR2

DIOPT Version :9

Sequence 1:NP_001247118.1 Gene:CG42404 / 41842 FlyBaseID:FBgn0259823 Length:1133 Species:Drosophila melanogaster
Sequence 2:NP_005128.1 Gene:DGCR2 / 9993 HGNCID:2845 Length:550 Species:Homo sapiens


Alignment Length:340 Identity:84/340 - (24%)
Similarity:128/340 - (37%) Gaps:111/340 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SCRDYNGKMYETGMHYMP-GPDSCRLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVIC 91
            :|.|....:.:.|.::.| |.|.|..|.|..|.|:.|...|||....|:.::.  ....||:.:|
Human   270 TCVDIKDNVVDEGFYFTPKGDDPCLSCTCHGGEPEMCVAALCERPQGCQQYRK--DPKECCKFMC 332

  Fly    92 LDDQFSDGSTDF-----GIXLVASGITATLSLSLLFFLVNRLRQRKMRARENRQNAEDQRSIVGS 151
            ||   .||::.|     |:.||.|.|::.|.||||.|:|:|||||:      |:..|   |::|:
Human   333 LD---PDGNSLFDSMASGMRLVVSCISSFLILSLLLFMVHRLRQRR------RERIE---SLIGA 385

  Fly   152 -----------IGYIAGNMGYMEGNLSAIDYSYSG--------------AATHYP-LWKPHFPRG 190
                       .|:..|..|:..| |:.:..|..|              .|..|| :.:|..|  
Human   386 NLHHFNLGRRIPGFDYGPDGFGTG-LTPLHLSDDGEGGTFHFHDPPPPYTAYKYPDIGQPDDP-- 447

  Fly   191 EAPPPYEEAV-------------AISQAEALSAQCTVSLPA----SSQRTVATVSQQQQQAVAQA 238
              |||||.::             |....|       |||||    .|:..:....:|.......:
Human   448 --PPPYEASIHPDSVFYDPADDDAFEPVE-------VSLPAPGDGGSEGALLRRLEQPLPTAGAS 503

  Fly   239 QAQAQAQAQAQQQQQIQAQVQAHQHLQQHTLQLHTQPQQHHQPYSQQLVAHPHPQHPHST--ANV 301
            .|..:..|.:                                  |..|:..|.|....||  |..
Human   504 LADLEDSADS----------------------------------SSALLVPPDPAQSGSTPAAEA 534

  Fly   302 LPQSNQYTQSTTNLI 316
            ||...::::|:.|.:
Human   535 LPGGGRHSRSSLNTV 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42404NP_001247118.1 VWC 32..89 CDD:214564 16/57 (28%)
DGCR2NP_005128.1 LDLa 30..66 CDD:238060
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..92
CLECT_DGCR2_like 115..267 CDD:153069
VWC 271..329 CDD:214564 17/59 (29%)
Atrophin-1 <428..537 CDD:331285 29/153 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..550 13/84 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.